ELF(4,4 ( p\\`\`444  TTThhhhh$$u $u ttthhhDDQtd/lib/ld-linux.so.3GNUGNUHˏVrƾY ܏ @ ! pB " f  82 h?@ABCDEGHIJKLMNOQRSUVWXY[]^`abcdefghijlmnopqrsuvxz|| ~N /tnv3eP&] dqcE! 3uiшJ#l.:aݯ$4軭;W? f|vE *Ufx1 WۓV1~/N=u R_vG}L2˖}XCEYy? GuK@zy4l?~|x|ѻt~'6 -2@o9|#2Uuݣk8DO!巠5Rϝ|&) `x4mݺtU A ͊2_t;{+keֽ߄tW9ʼngUaV MQ-=-!1e{|MCƑqXvT\GC;/Qt (JHb =$](T,_0q48<@8D3HML"PWT0@--CƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌ@-pP @epD` $8 8 S$D0C@4 S$H0C@ S444 yN$L030P UPR\O-4M $P6Oo堯,sp|0S@00 0 $5LL?0V8? 0'&.Ph`  &c& $p ` 0 00 p0   @R$ttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt`ttttptttttttttH4thttttttttttPLtttttttxtttttt4tttttttttttttttttttttttttttttt4 ıб,@8h(@تT X0$00 09;01C1gP 0 0/0F"L˟0P(vSC 00"$˟ Rt 8R R=Q B  +" PP P cSK &dSV gSK,0000000SN hS/ mS1 nS$ sS600000h0z0ʟ0P ;0P00 ( P` 5 5)|; `+0009")tɟ !B! -Q -Q h 0 0 P0,0  t*: *:  8 8z8 v8 r(: n"X(i8 edht P V PO 8H A : 3 , %   x `  H{ 0t m f _ X Q J C p< X5 @. ('         } hv Po 8h a Z S L E > 7 x0 `)  o0U 4  U P K }E|D Pt# Pk# Pb|#p @YP @ MJm0=SS  0=SSSa 0 0  q0  000000dj|2 p2 2 T2  828 P 20P10 -R0S 001  q 0 0 8R 8JNl1 ^`1 Zdv ( T ċ,~ ` @ DHDēl0|<tLԗ$Hؘl@@d hlX̟ܟx X ~ l P ` L x  T p PW~ ~ ` 8 ~ hpx\ ~ p ԎD d ~ < 4H lh (ġ0D$<0$0 m/pP4%100S81, 1DpJ0S: |241080NO Rr00e T 5@2: $9/PP8!@K d 0gZZ 0 pS @CT}*0@+Y!S \S  0 R"0S 0 S Q@ 0 Q01 ' @ 0pS0141Sc 0S`1 @ S5 0pQ Q1 00 $19/ *PPO 8?0 $19/Pi 98!P0 $19/9PP8!0dI d@YkE Y1 R0 p1pIg0d $19/PP! L81P@w 0 R111S.\841 HNO9/P P>̨H Y2E0 Y! S1X1 PXVOy1 SS U@0\T  00S*@0'S0D@DcP 1p S010S !01 ]0 pS0 @1S1 S2 S 010 S,1S; @18Z?*0@*S0@ R *S T: $9/'PP 81@ R ! !0@*ST:$9/6PP 81F1P& SY S0 @10pS011 CR01S010 S @l 1S 0C J@J 1/\ AT P0 @S S SI 0p@ 0 %SFZ:T$A9/P> <8PVO pPS @1 0S*0W\S @00 Sl Z:$A9/PP 81 *D댤 | #DpD0pS 01 {&AT S /\ S S T T S 0D S#,,,,, 010 pS 0J@J1K0 S01 00 pD -039D @1,0p- @0pS 0J1@J $ 0SU 0p0pS 0J@J10 S 0J!0@JT*Z @010P$19/DPP 81@ U0@*S0 D0D 1ASj  Q}C0 S 00! p\ @ 0@P0D!So Z:0N$A9/N/P8XH P)UC0pS 00A1NORU@0fT t'T' bT@$0pS 101>0$19/0PPV 81@0$19/P@PK 8A0\\  0!pu(u Phav 4\5гĊT(`a@1 0CS010 SG P0A PP#\ @00 S U$A9/0PP 81尠@ B0rT @ tT @ nT @ 0!10 $19/,PPQ 81@'0T$19/`PP8@tA4AT U00S 0EP0S@ T@j@j0gS@CTp  90@SU1@ 0<$19/L"PP) 8A0$0SX 00pHB0 @D0J S0 @10 S 0J@J1  BB3$/S 0B@D80@0 S T:X$9/dPP81@&BC0 S 01 l/S @D0B1 @D1BD@D]NOZ0 S0 @1mQJ@J0M/S@D0J& 0L$19/XPP1 @81xD =A-PMp`f0T@0 p0#0 Qp@c B  Ѝ萀 A-MP@p)*` `f0/|C9b ```` `vP0 0c]j庎ڀЍAddv ,C@BT@- @oC00S@T dv P0@- MP < @4 E(00$ $0Ѝdv hO- \Ml .\p  tip&Alp0h0 -S+S@h@+0h0 I0Dp%S񟗥$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ PP= .TP `t Php` 0T @@T@pTP .T ZP00Tt `+ `P PX@" x C xP  PR@ ğ @ 00 P0A@S0@D-X@d`lVP,0P0Ch  ` 0 K  #PPh0@+SN P 0  P0 Pl@@ KTP0SB = S b  l zWEh#[EQ5\#%WPVP1H# 0e &i`&b`↠ !@Р @JŸ pG 00X X0 B0 SB(RPU0S 0J0V R`F0C +0<0Kl0 PP00Mo pH D @  M@dL "ŸVPE ` `PT+ `p Xp PT 8 4 \ pP K``KQ  W PLK %h00 KP8 K{%8KA%@P`6` P@5t `@1tQ2    `00 0QP``Q `@l0pP P0p KP`p)`KP+P@P`D @ȣptx$ H2C4@-(@ 80 $(v A-pP 0` 00 @P   0 0a 0A-pP`p  @l0 0c00 0P 0S-$A` 0 S0'S S; P0S  5 \ 0\ S0CS  S R R 0`0/0|Pt 0p `V p  'R `p'\ p  \ 0` 0/0ꐀ @-@$ +,000S 000 00 0v ` @-A` ,M0 SPPP0!0 A? 0 RU N,ЍpPu0pP 0S00U  mPFyPB0P`s``A  $0R2:$ j $ 0R( (00 ll R 00 Ť 0  0S 0S 0SD3G,ЍO 0 $I m$00Sꐀ  h v \ @-BLM`pV3ppR0 R000S 0S 0 !400S00 0 R pGWw4   0S  n>E` 00pp$@0S0'xq0  <0$0RI:$$ 0 D$0S( (00a aP 0  000  <0S 40S 0S20S lEQGLЍp!Rpppp!Rpp 00pp$ $ > v Ԥ h @-(M@ 0S00 0 S000 00s03 S@r@@@  $0R+:$ X 0 $0S( 0 0 0(``\t0 ll0  0S 0S 0S32M(Ѝ$> ꐀ  h v @-Q4M`@V_,1 ,Q  p x -=; RpK =(0SWq$A$  $0R2: $ 0 $0S((00ll P 0 Ŵ0 0  $0S0S DxF4Ѝ0S 0S1$ jD`ppp3  h v @-BMPQ 0S) )0 Q   0S942  Q    0S  =PEUs <0 p ` =0 p` <\L\0  R00 0 R \ $10  0S 0S EЍ0S;1 R0 R !   R  00 00 <.<,,, =v 4h e@-@P5 00 ! 0  R* R  00S 0  R00 0 R @|E0 S R 0S0 $ ?<v h   dp@-TAQL 0S. < *<0( P` 4<0 P@ )<00S 0  R00 0 R p@)E (0 P   Q QRi00   (~;v  h |0@-4M@X 0 S0P,S \ _;K4Ѝ0X RPA k( R02 A$0  $0R/: $ $ 0 $0S( 0 0 0(``\0 Ő0  $0S 0S 0S/D4Ѝ0U0p0$ PpP3ꐀ  h v 1@-@0T.S 0PP00IS P P |P t0PPESX lPD fP0 `P萀 v \Ħ̦Ԧܦp@-@0Sp 0SpP|| ;0h `P ;0 Rp4 P @ p@ ;v  ,`p@-`P`@0`SLp R  \ *\0 00~0pv  C-`@APp$W*(((V $uPV oP @ X *0Y\S 0t\SV\ _TPW V \UA-pP`P@0S 0ES U 0:U``x@50000T /0 UP0$000t0``v 0/v p@-``P0Sp@T Pp@T@ 00@pv p@-`PpPP | 0: 0@T  @T WPp$ p@9v T @-@ 0`pPpppPPhA-ha0SPB 0SD1 p<1W@(11  #PP5 0W !:PPPP 0T p@ 0 @@`  0 0 T i0S m 0P0P P4"v ~  ŢhO-QMpcP'0S$ ! R 0$ 60CP$0 /R P IP  01 RF0P P @p (0pJS2 0@ 0( @Ra TP 0P(0SY  1 P4Ÿ U3*Y 0Z 0 @1 R05P$pЍ0 1R P0P00PS10S1S tP 00PS 41 U4: 4 j !  0 , Q 00  F 0 Y( 0 00 , n 0 @Yp  @0 v p@-@P@P` 0@8Q 0b p8080 v p@-`@Pp  jMpP 0UTv,@< YM<00Pv @-M@ at 0 S@QP !`0 0S0CS 4MЍQP )MЍ "M0@A-M(@,PR` P]v+  QV `SR p3bPĕ0<S (((!V8Ѝ0p0 ?M`@ 000 SR% `M   0LV 00 0p@P 0 00  8T"ܧ8@-@_gPg 0P #I80@- MP@Lh 0L Ѝ0@- M@P`5pYp 0_ Ѝ0@-4M0@P\ (0B@ 0P0_0 @0 A4Ѝ0P~ @-00S 00S 0S  P$0X` 7Ta00@-SM@P Q P  C00S0 0 WgHЍ0QS D404 0 f1Ѝ0v h~  ~ 0x00@-0 MSP `@ Ѝ0#w,0 0  0v th0/h@-0  h$ T0@-0MS@<00S Ѝ V PwЍ$ v 0@-0MS@Ѝed00P0 L000S@00S 0 00 ~ v v p@- M0 S000"S* H=@PQS`P! ?T0#0 ?T 01SЍp Xe6ЍpoR$ W6ꐀ v v X<O-$t M0S= d0 R00@P<T0 ?T儁 R 3S0P @ 0 PS+ C+ d0lC S000! <,#0 S00 00+?#000 K 0  "0 S 00 _ GP BP 0  x7P 0  P,P 0iS0sS 0aS 0S0{<P0i PY0n<PM 0f<  QPX000000N x15 K 8 <0 4 4 4 48,   M !A( 0  40/, (<0 0*C `5` Z5Z S50Ql K5KX E5E$ v h hv ĩt|<4̩@-;QP$ '5@E 0@J>T @-@(me0(  QHH~ @-H@dO-锒,M0S( b0(p0Mep@PHa ?Vy0S X 0AH 0@P!DAB,Ѝ((e@PT0X`` pew ` 0 X 0 ?I`( nh~\d!0UT@0S DDD!4@A< P0  I  P0`  0`! [0< E<0`w0  0000  Z xx 4dtt 4H 0@0[ 0 E`4 4~ z dPTsv ]@- 0@  v d.O-`M4PX \p3<48*PT \$8@0p3SR P| < Ѝܽ81 <0\-@@P  0 S  0SPH@JPHD` 0P&%d0 %@HH@lE ~|zx8(0SP8p 0WP` @(0U:a800S* \$lp8p s *0 00W*0凱ᇁX 230a00pW:0Hm8@4[ 4\0[ N[ @0[ 4+0[ 40 `$ @ 4P U 0$ +]WQL@ 0jm gY7 ^N 0 00S  @@ `pW }X u0S  H _@H 0"H[  00$000 0S !آ R 0N0 244Z\Dl<Z 8@0S ZㄸHZ$Zl( \$X(X H(T8 <00coSay@00S $Z'0=<000coSayTP`@8p< 0P@ HH @@H00 @-(!00H00 p@-@M 0 SPPP0 %S 0S S  R0ЍpPЍp00  P00`[ ? `ꐀ X@-<10HP0' `6QP' @P@PUT` 0 0 0 0SR R 00,S  0@?(900pp 0@0S S 00<p 0@PUT p@ 9 p ج 41p@-0HP$' `6QP' @P@PUT` 0 0 0 0SR R 00,S  H/p@?800p B(0S S 00<p 0 0SR @p@8 p d0C-Qq 0 S@@0@`` ؀` P 0_S` 0 0 S@@0@,S 0 8t0`hP ` 0 S  00 @0@@ꐀ ȭԭ0@- MP@(D 0HD Ѝ00@- MP@D 0:D Ѝ0p@-`0M P@ ڀPJ ڔ4P- 0P P| xxx$/-P @PO P@T0 P$  P AT0 0Ѝp0Ѝp@T W@@TP~y A/?  00"AOCQ@tPT0`?VC @`hPhU 0"(@`j@@? P.2P00 0P f@?T2 @T ,PSU+#0#""#FP 0S18 ?vP1Q!.  0@0P$EpPp@T0 0[^b@PbTP`@U?T$UT$ 0UT 04 ?! @ o p MD@- 0 S0,S t@-ꐀ P@- Pd%%%x%%L0@P  8.p p@-`PU$0 @9tpp O-4M`p]@P]00@ ? GgY ; 0  @0> 0 0@] > 0 @ >@6^ 0p p^0 >2`VX r g4Ѝ0 B(0>|0 0 0@렡  > 0  @ >W@00U] >p @-@0H0S  -@<A]`Pt0 H0PP0 SPPP0| 0(60H @i LpQP0p6 H0 P  خO-鬅,MP\0H H@`\A 0S L0R!1R0S (0(Y"QPY& Y+ 0R04 Z) Y 0pS p0@ T ڀT T@UT P@\8h 0 0pH@`L P@@ Up0P 0 S@S #S S 0@S S S S PUP4P\@P\~\0 0A= fZT 00 0j 0SbZ( 0S@@PP T@PP I@p^i =P 0@T 40T @40T e,Ѝ0 z0S P0S LR 0S S} T$ 4 T< TP@U6AUT1Z< Y+ @PT & QT# T T !3,P@U P @U 0 0[=TP@U  @R P@ ) )0 0R`h` , P@Y 0@S S S  S } w (@-@00H0@@ @-$@0H0 0 H  @-400HP }[@t4 G+@&; 00H00H/ @-@ @ H  @@ p@-xA0HPlI d`10SH O[H1@P0`-1@PUT  +@P  0S SUT @ p@"4` 0 0 0 0SR Rp 0 0SR0 0T x*p@:0H06_@P`UT p p@-@M0HP/ d00S Z{`P @<0@ 0P,S@ 00&0l 0C0Ѝp@30H0^@P#UT$ **Ѝp@j:  pA-P@o $0% R0`p 0A Ag*Dp@-@P`  `AH @p 8@-@P 48@-@ 8@-@P0 0@H0 @8 @-@ @-@ @-@ @- 0000H   @-L 0 HQ0  @} @* p@-r`0HPS c20SB #ZVW  V 'V V.BpqPb P`0 S0,S  V0 42VZ SAV0 H00L  Vc \ʥ@2V: V$ -V !8*6`0H0^@P:UT A)@9^00H0 OV0LDApP P`0 S0,S @<0 00H00H@-00H0  P0:@ @s0 0Pj@ P @ @@`  <pO- rM0S R0<Ѝ1aP`P_oPPeP qP @T@0T0p`pp 0'0P e@T P< (00 00`+@P  9P @VT@0T0` P 0 0S0  )@T0L [(00 0 0@P( p w  ԭL ȭ/7O-04MSPv0 @8P  2P0S 0S `4Ѝ 0_S㌆ 0S V`P000SL:<<<@<<;:@0T0Q Q 0Q s QQ`V0S 0Q QQRF @A4 @a<4!@PSR@ _1 @ ` P0S SR%0  00S 0cS0+ 000sT S0S 0`c0` 0s00V00n l0S 0S 0 0 0a00^ ` Z0SSUU`PQ 0 0M0 0 pmY !R!T0bY@_0`H.0S`0`0@P R0R@0PX RYPZ R[0S0 bY ! P@RPP XQ@! ?R70Y@k  @R R!R0 0X `V  ?  0 #0@ 0X ` 0 X0XPU PP 00\ PJ@SRP XP 0U@0@bYd !PP0 0 0L$\ e\%0hSR&0SO0 S (pW@!z\B@X0 0z\q 0S0@0@bY. !PPL ~ ȭԭHw $w  @-Hp`(*WqW@P? ~@P00  P00P000H  0H0  '\ @-H@@dG-`M(, pVPH@ᡡW  ?JP Q@- $:Q X 0H! 0@P!DHBЍT0+pX 0X@T0p@@X@! T0 PpX 0X@\\\ &H@@ &H(,$ & &H\D0S/ 3bd/ 0 0000/8@-d@` ``0PP U H & 0 8  &ij T$O-0@4MS񟗞FGGGGGDGFGGGGGF@P(@,Pu`@Ym ?0 0  S%`\ @ 00Y  0( _V  R P000ş@PI@P0`@ PP$@`Q 0 @ P P 0hSK $HPU@0T0C0P s S0P@@P@_V@P5A (, P(P,| 0(, 0us@ \P0rP,0@0P0`@P(@\ 0t B%Ts@T 9%0T@nڲ sDR ThT ?@A 4ЍP,0e S?2@ @堂` 0\&@ Q:l2P%" SB(R Q 12`P0 \,Ÿ Q\: QP`*0 #8@ 8(\8 8(@P@bV fVQ @0 B@ 04Ѝ:T2ʈ!%0P 0bV8@@AQZ@P RP88 K$@00P 0 P0 #8 8( 8TZ TP0\ P8@@ e  ?\ QZ 0 0@0@P@@P0@ꐀ , t0 Զ00@-S$M@: S S4 S: 000 0SP]0S/ !@ P0 @$Ѝ0 R 0$0 !0@SH $Ѝ0,0gT~ ~ lw ̷ܷ\ 80\ 0S/ 00/lw -M00 0 Ѝ` `0 -RM H 0 }[Ѝ0  ~ P D D0 R 4 0 /0  /~ P 0   /8@-0@S@P #0@P8Զ0   /O-p4M 0G` @S%PlPlPPNNNNNNNNNNNNNNNNNNNNNNN  0ZNP `7 R 4Ѝ  0LNP   0ENP W W  Q(,/ 0GS0G0WS 0S@ \) Т P7 W 0GS! S Rx60\Y l6\ P RWW 0GS" GPSRRRRRxRhRXRRQQQ4RRQpQU  0MP 0!W WWQp@4Ѝ!@P@H Q @50S b\P p!@Pp W W!  0!    ?!Z  0 r0! R  0 r0![Z 0W! R 0! R  0 r0!Z  0 r0! 0!  0! " 0#! 0! 00 0j J1,1: J* j0: 0   0  0*!0 po gpk 弒 \[  Q^ 0"Т 0 0 S"@TPE 00  0[ \Q P[Z5 0 S 0Т! WW 0Т S^ 0 10S5 10 SE Т1\ R 0GS40S W~"Т"@P!Т@ P\!SR00( Pz!  \!!Т S Rj 0QL00S 0R(0Q 0 R\ z 0-0x@ 0P0 00S8PP 00C  C0/᐀ G-0弋00@M0` S@PP;p Ra! I]R񟗅TYP]P]P]P]P]\YP]P]TYXTY,ZP][YYYYYYYYYP]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]YP]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]P]\0@00 R00P ZW XX0S S Ѝx9ЍOЍ`0S S( S+Y ]-Y ~Y"Y0 00 0 000C0 Sc @ F(Y @K [Y  0 R00ꄘ00 p P 00@4@TT@| @T00 0 S0(S,PP0' SP AT rP@  0@ d0 S0)ST X A N0 IHR00`0`0`0`0`0`0`0`X`X`X`X`X`X`X`X`X`X`X_X`p_p_p_p_X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`@`X`X`X`X`X`X`X`X`X`YX`p_p__p_X`X`X`X`X`X`X`X`X`X`p_X`X`X`X`X`@` 0 0@P@5 0@ @V&VNW@ 5PB 50TI 0@P0@0`5 0P00@0,şS0@0 0V 0 %4 R'  0 :0S  0 @T-Yq-Y~Y4  S TTR ʂTT/b@ 0 0 S^ P }008#8S0vPß 0 .0^gSRc0)S  )L0@@=RPP\3 b? H R Z0fUP @@ #3@P T0 bR P SP0E 0 " @@YO  )PJ @@-Y" ~Y"Y00V !Y 0 000$ P00\0]S@  y]  r0  k !Yt0SE 0 0^SR0P  0 0G00-Y0 +R~+RPRQN   LP0 0R0 0R0  l  됀 \ h|~ P , R ̸ijt0 O-\M(, ; ,\0 Q-RD =R  .>R |R< |R2 ,9P X(p,`WV \<P \Ѝ&R +R" !R  !R =R! <<R =R >R <R + &R +弐!$Y  (` P[-SB =S7 >S( |S 0|Sn D;pp0Sa P0Sr  @ PY Y 0S S l@i0 000 [ :[ Ta * [ T[ * [ TU 0T [P Y T BZe $*(` 0V_*0 p`0@, 0e3P0S@_ Y3 0yQ 0pSp R A0 P0S$R\\ - 0P$@Dz0]S2  R 0&S +S !S|0!S =SppYP\ 0Sf$ 0@D   0@`D`P$ 8 0 Sg  0P\{ \<$PHP0S8dcp 0IS 0IS-ll onnnpnXn@n@e(nmmmxmLm mll<S0=S >S <SX7p`p `P\0IS1 $@00`1$`0=S\ >Sp`p`0=S? ``Tv`1$`0&S5 x6``@0Y0p$ 0 0S[5[ 0C[ 50[ 50[ JP: @0S; Pe``pppppp5````{``wppscW?VR 0ISO( ?`p#`$ $ 04 8 =R/ p$2 =R >R--Yg$P[b$D[| 0D[y $40[u 40[q 5JPl@1JPg    ##娐#340p ' 0 ) c0 p000  D 4 00  = cVp  0 r0 cRp  0 r0 cVp  0 r0 cRp  0 r0 cWV  0 r0 cWV  0 r0 c R0 c 0 c "0# # 0 0 c 0 00 310` a1 F212&0 0 0 0 @1 `21 0 #  & H0 `pcG  :@eIPU0@$0 U$08 P `$`Vp#`Vp`O@O#`p 0 0`Vp`wꐀ ؁ ~ \ @lܸܹȹ-M Ѝ 0p@-R@P: c ` Q"`!*`` a"0 ] 00c0 0 0p00C0p`b  J 0` `0p-M+\-\ R0+S-SL @P ` @j Pip @P\`g -0+0`rf@EAR`0I 0` SR0Rpap᱀, x,h'ȠS B00? [ 0  P 00Ѝ/0p0p0pV Q 0`0 0 Ѝ/0K00pKSpp0 `CP`0@-@P L@0S@ -00$ &0,Bx P   0D0D0/~ p @- 0@bQ8PQ( ( aa\ ! 00 X0 ` aX R(p  pa(pQ0 00PX bW\ `d 0@-|a|Q 0@Q ``!X!X1 RF 0X $0 b?D R?P!6 @ $00S@  @ 0( 0apaP$00$ W 0( 0W  }0840A000 0 S< X@ TP 0 0 40 40    |~ d G-p`0($  bR(P 1("X Jd R@P 0DBAz0($  bV i  8@-(P@00$@$@8 O-`P@(8pd0d$ $?H@C D(B,p!489   G-ddB` 0 $DB H0a(, @48   0D"!/00($0c/ 0@-\M` @_0@ `Ѝ0P` @Q` `3Q@VPR@P `Tp?WV@Ѝ~  @-M@_p@`m Ѝ@@-0M@@@? \@Ѝ< <0 R 000 0$0X`/0/~   < <0 R 000 0$0X`/0/~   8@-@P0 ($0 cQ@  Q$0$P840 0D"!g@$0(  -@РMZP @ P@ p` &$p喗)a0 00@P\ \ DX DX @P$`,\,A0 00ZQ Q DX Ѝ/0@Ѝ/Ѝ/pЍ/Ѝ/O-PS`p(, 7 0@H\..R** opX10AT \ @  Z  OP0SX 00 10 A @-H0@-` M4m0 000Qp@2 0bU R00 000 00  a aR0 00` Ѝ xv P0@-@@p@-@MP`k  0aP Ѝp0`S0P0  0   ll P   P ` 0H@-@MP`.  0$P ` Ѝ0`S0P0  p 0    ll P   P `  0Ѝjp@-PM@` 00P  `Ѝp0@-P M@ 0P  Ѝ0- M0 P  Ѝp@-PM@`  0P 0@T V  0T0T@5@5* Ѝp U P<@-0pSP` AT  5/@T0`S/A-@pP`pP 0 4PP8 `o@ 8pw 0 /pw / /8@-(PS@ 008pw  @-$0@R @pw A-`BPPPMZ P @P0S PbppP$P>wF #W. PЍ1P P0S xP @E PЍ iP@6 00PЍFNP AP/ PPЍ}   P P  7P0 00@ P#  PP T P08 00@00pw @-@P 00pw @-@`PU& 0SPU x) PUP`P@ piP pw O-pDP` 0 @@p0p(0 p0,$84 p<00pp0 0 0 |w @-D@0 00 0000 @|w @-@PH00@|w O-@<(0|0Px p` P@P$  p8`4`, p0`|w P0@-@q3P( 5 0    |w @-@\ 00@|w @-0P\p&I@Q0 00 S x` 8 p@8\`\8pL8Da800 00  z` d|w w ,@-0  |w A-`r`0XBs! $S *  0 0 70rS[0 P B0 0 A I PpW@PPQ 0 0B0U S 0E Q0C0 R"pPc D   0 0PP  pB0U S 0E Q0C0 RPb0$,0 <,00 `0PP   0PSH O{<00S0@P y|w ` Hh 0/|w ,00s/ 0 R  /|w 8@-@R(̎̎̎q'00q0S P  |0  8Q\0T LPP P @8$$$ 8 s |w l \0 R Q /\ /0( S Q000/Q00/|w A-xP`0SK@Hp@0 pR@@ @d @-0#@8 O-pMW <0S <0S 0pW090p!Rp!Zi`@P @!P Q` wX xpI!T @DQ 0X <0\  0 Ѝ Pp  ` p !1##0Z(0s0X 0!@PT  `$ 0@##P L 0@PT`pp 0w 4p@- A00Q@0`0 0 @.R V RTPp,Ppp@0 PB  P<  P6  P0  P*  P$  P  P  P | P h P T p3pppw <@DHPX\dhlt@-xpP@T @T _P0`0`@00 00w p@-,AM 0S 1@ 0S; P0 `P 0RQ(P0S  P  R $ R\(``P^  $0`` X  @ 0 0Ѝp 0SЍpw |؟-0@-@@M0 P 0000Ѝ0@ Ѝ/w O-r弲M@ t㊡ P-0 | w R Z P@' 0 Pl P@ 0$ S`` Z0@ YTP! `@  J 0!S `V `V0S1 0S.  务T J&``0 S V*0@ TP00 Z@0f0S0SЍ  `CZ Z@ @ 5ZQ4  0ЍO<P@`w (tO-q(@ MT, T PQ ',l(\AP,P QHH Pp@, `P X@ƅ,`P Pp@! T @0,00 P [ P00S ,tPX00.00ƅ0ƅ0ƅ` P ` Tr T0q0 t 0 0 Ѝ ,00w (@-@ @@-@ @O-R M0`SJ r RE  2@T ,0S P0,0 V7 0hh@ ` 0 00<2D R4@4@ @000 0$000,00 0P sP0,0 Ѝ iP ꐑ 0刁R0Q P 6P 0\ `@M P:4a[6 0S:  \^. P\S "S,0S k gP 0K`  S00 }X Pli0 0sk h ~ d w   8@-x@40S8lP S8>4  0S@000S <P< 00S0008@'w d   O-읟=tMP$P00 P  0- O \; ,P dtЍl=0 0P !1( ٿ4 0` 0V p $0QPS񟗰آ̢ĢlHX]S S X@T pW 0 pW% 0h ,0S_   60 0$0S  SX`VP p B P0 A 0U0S (0 0Sp3 :  p ,\ 00 0UXPE U R(  0S*0S $0PE(  (   pP0 QPPR 0 pXuXPs@0 0yX @H:0D*D:Pb4 Ծ@V `Ϳ@Ty!@TP 0-S0oS vS0S <0`V `宾 4`@x @墾$ (X @噾H9 8 @叾 )tp0$#(0P @{P 0 *p m@;$  ꈸ0 0@T lXlx`E<0S <D80S HP9 F@P <U <V<U F@PXw @TW`XF@PR <P <0S <UV y<`` q<P A 0P(X= 2GPK .G<0SF  (G<00  "G<0_<00L<0P0 0g000kttt& Vd0S0S @P 04 000 0 000~ "<< P0/W3 @+ Wg*0 T l0QS |!0S |1l0 880\Tş8040@40p00 0W*(0S T, ,P 0^0\,(@KP ,  Q U,G D,MW, P , Pp00 P0q0 P p x, W0,0\,P0 Pd0U|Q|@|Q0 0PR$*0S!|1l0p@0 Q  Lß 0@(ԼҼ 0 A ,P0  @ 庽$  P20 0 ۼ a W:l00p0 `V@ , 0f0 P00S P  Rv ,=s00\0|1,N000C,0 Pp  <  P1 p0@Pp P`@ P# ,0SŅ,P2@ Pp@P@` P~ 0Ppsp<0D 0,o408p0 0@P@`p, <0 P00S PppW ,w (h  XlT  \ ~ t؟w  0$/w 00S0 0$ /h d @-00SP P P ddd `00$ RR  $ <00$ R $$ 0 0$ h $d 8@-PP `@8@v H@P <0 ,Q   8@h  P׻  (0 /C-4Q M 0 S0"S  0``S" p "S| P S 0 S V@P 00SV000 ЍC" Ѝ` 㑻 ЍC@iɻ  i0 X $(ꐀ h Pd (0@-0@S00@@h d 0@-0S0@h d @-0㚻@c.a._.00,0@-@_.].[.@8@-PP @TAJ.8@ A-P @R`p0堀0 00S 0S00&S@T.0@T:M. @T*0  @?.0y G-` 0P p$ P@*00W <10S @W M. P( 0S- 0S0S@S @W0Y 000S@S (0S\--&W--Y 000S&S- . ?P0y O-\MP8$ v-0 ` @ T-*[+&X \X8 R R   \g  Rd T_"X  RL@X X  @-0T:8m-V @- t 3 T` \ЍQ[* (R @R &R PQ şL 0 B $@\ ( BQ$A Q (P 0S3-0'XO @XV =X R*0=S @ P@R\ X* 㚺PI 88-0S'  \@ ' 0 0 08 0@\8 -' 0 08-0Sz  0S *&Q @ -0=,@-04 RZ  R*@Q @)0 S S\-00@ SG ,0`4(倐 0  0 C-00@ S{ +, `0O@,`( P0 (DlL D,( 0P (`0f@T*)Q!  )Q ,0@S\R    8 07 BW B@l D Dm,@0 \, X,@0' 0 00`4(0~8C, 80@8i, P 0S =,0g/,@0bl 0[$0!,0U,,8+0J0y pxd\G-ᜑ0p@`T-* P"U <U4 'U% R" @U$ +@0T* R\Q*Q !Q ZU@T*U T:@+@+Q @P T*!Q <QP@+ 0>QU T *PE0@+Q@0y O-@P$M`++0P@{* S0z0%S( "S <S R 'S  0T`*p0R [ [X ,[V <[ "K;Q񟗧<<t@ )+ @T : !+ @R[T/ ᭷$Ѝ  0'R BR$ p,S ;S Q R0 R <S *0@0 (C R S[Rp]]*0@S f(Rp))ZpG2* 0SE 0 @$Ѝ R 1 R ⻷L p0S.  pl 07/ @ D *0S 0S"* 0"@*t0SQRy HRw DRt0y O-`$M@*  0S* 0 0 P 00Sp *p *0Sa W*0:S. =S_  Pw 0\  0 0 0 t 0 (0,0PS o* W0 P:0RSt$Ѝ:00 R] 0) 0C* 0p7*P< 0d  0Ŷ 0 0 5)&*p0W*00=S I*,0Sp ) 0  0圶 0 0   0rS0eS0qS 0S0,0 , h$7P10,0P!1UPP@)P   [00 0  0(0@$Ѝp] 0Sp@W X  ; 0 B t0y |4<A-P`@'$$ $p@P`p0y l h 0/0y 0/0y O-M0制03/0S }Y `c0 0@[*P R R p R RpW: )03/P Ѝ p0   0S:[* p R R ( R R$Qp: 0S* R R  R R0S::R0S* 3 .R2 ! R 0 S0  p3P 0 R    00 0  P0pW 00 00S 0Ѝp0pS  P  P  P  ڵP  ԵP  εP 0000004EP$ 0y 4<@HPX,O-M$p<@`HP@((800 PP g( 0 d`PQ X 0SQ0 M(0S^ K(Y(P( 0P%:U* 0S!0  0QqcP  㼴PU= V00U, mЍ lU0X*, 㡴P 㜴P''0Y*0 0(S  J0  Ѝ }P P 20P*00)S UD cP'd\l lh O- TM@Hǟd h `0 070S .T K0@  0 @ 0@P`00M`a 010S @ 000S|6 P\ PK'Q QPKF'Q Q Qd 'DK '\@T 3'@T\@T@T (0SuP LPPKO'`X` PLP@P0 \ S ,S ;S ( C RYBXH <\BPY0=ST X0ST ,0Sz PK NP 0S`(0S@T0Sc P 0,SP0 S S\@T@T ,0S PP ㉳\0 <\ X 'S Y=S Q*0 \ S ,S ;S ( C R0=SDK&D0KPKL K,P00P=S\ DK&P 0SS PK 0S0X0 P 0X0 0`SPK&PZPL  e&LP0Sz @\0SX ( 0RSq@(aYXT@'P0 .R)P]0 SZ SX \ 00(  PK  \0  *& @TL 0S \PP 0S PPDK%T h PK@%`0S\ K`w` 00 00AS\\ 0d@ 㯲@DK%0 QDK%\@DK&; @8Kv8K% ㎲\0D DK%PKD K"0X0 P< |@0y l |\H(H-P00M 0PA t0   0 SX`PQpP  K EpKl @O-pLM@pP%` =%0 8 P 4%(2%40%0 P P `% bP  LЍ LЍ LЍD@:%{%0PPP*W "RP 00"S T%0*P-*4%04%  0;PP Z 0 PU*W4 ep 0 %PP  :% $%P4$($$ $ 0P,lx0@- MR PX@ LH @刱Ѝ  R Hy - M  R 0S(0( Ѝ Ѝ0p@-MPP  R@ 0|@Spα h`?Ʊ8 o`Ѝp(庱 BHy 0p@-MPP { R@ 0|@Sp嗱 h`Ᏹ 83Ѝp(僱  Hy 0/Hy 0/Hy -0@- MP4@g0 0妱  Ѝ0@Ѝ/-X0@-@}MTM ~΍}' 0妱 a}ލЍ@Ѝ/~ -`00@-0}MS MP@ ~΍ }' 0励 E}ލ Ѝ0@Ѝ/~ --}M M~΍ 0'}t f}ލ ЍЍ/ -0@-}M M~΍ P@ 0'}] O}ލ Ѝ0@Ѝ/-l@- MP0 T0`c ( 㒰0P *T A-@MPp `CʰU  `9p 0ὰX @.ᵰ0 P$ 0ᩰ,xT@-@Mp`TP | @ 0ᏰT @ᇰӰ, @ 0{xG-pMiP@PЉ,VT P v0V`v ϯ PR 0 _ >pЍ谁!0YXЉ!0|!0YXQ T!0 L0 SR8 㡯먐@Y8  B 0 0q)8m0 Th 僯0S T8 0pЍ08T0 0pЍpЍ 0D $$$ >(o-@-$McDHL`@Q$Ѝ@-$McDHL`@B$Ѝp@-0@-S PݯP` 㕯 0&P13/00S08 +8 pPp 9PU L ` ( @p L $hD8@-`@P0S8P廯 P 8, ٮ@  a뚯p 0-@ $ !(,XL0("X@P    "R b   0 0/, xx 0@- S*d@  R 00Q S0 00@/000@/᐀ Ty @-@ 0S S 0    @-  oD0@A-@4Si,,,, pDAD0@ `cV! _\! W.PPb_\00P_\ 0cSP00P\b 00L0 `cV_\00pp |Zd W 800S b b萀 Ty p@-,P` @@fQ@1 `భ`pTy 0@-M0P  o0P Q LH@ 0 P  0Ѝ0 Ty A-a@M TP@+ pqp3 dQ XW@R*CЍADP X  0H% 0P#X Qp  LP \@ p  x0@Up 0y0%0P  ~ ~ $p@-tP@0`S D0S TTT V0 0@0`F H`$ p@C Ty L|~ @-`@0pP2 D0S  0PT0@0S T D 0RP᧼0@0SPD0SP U:g84 gᏼP  LA-,qM0@P`8 QP ! P  㼬0S 00C0S@@P0@0 ЍX0S p 㘬  L0Ѝ0(P ( ㄬ~ ~  $@-@5D0S@z5~ C- 1P Rq @`0\ T  'TY @SPQ 'S'@$ U\SP T"`Sv\@#`SvTU < 4`$ -X P8A-@`0pS \ dP\P8P P ac00ꐀ Ty p@-(M@`   Pa aBPh0 0P  @ P 0(Ѝp萀 Ty p@-8MA KlaPa   a PPC */@, ,0 , 0@,T  8Ѝp@P  * 0J(40.S0P l P@p0 0 0M@ꐀ ~ Ty \@-X00SL 0 S0004 P*S!S A@l 8@-TP@D0S 0@D0S0T 8 8 Lz8@-@ 0SSPP P8P! )00S  Pf)+ 0\ 8P U 0 $8$ ~ @-40P( ת@F0`  Ty p@-P@0`S T  T @T0Spp@T  Ty LP@- M0@ S00000C0 S0 0Ѝ萀 R-M;Qt2!A \ 0  SRQ0C8P 0Qpp\@@T @ALQpp ?CL`⣃ @pW`P`E@0LP`Ѝ/Q!A1 @x TB\  0 SR S0CRAQ,@p 0AǠ` ?W`CLSQ0 pHڀPF@Q\ H Pw P  @`Ѝ/@@P '@HD@P @g:D@G@@@TPSR, * -M KЍ@-Q`P@p `P 0S 8利P Q 㽩 ITy H8@- M@00`pP00`0000` 0P妩 x0Px堩t 0Sl 0ST00SD0 ?! ЍTy dxv PhlxD  ȳ H0@-@@ 0S0 Q 0 0 @/᐀ <00  R/00 0 R /᐀ 8@-@Pf8@G-pM8`@P X'W# 0.2 0`@R3B' ЍG} ? {'W620(0~ ~   A-M @0 S0,S5000! S W0S) 0P 000T@@T 0 `p0b @P SR)Ѝ ᾨЍ 㵨 0 S*  R 00Q# S0 00 |㖨d 0 S*T  R00Q S0 0ꐀ |Ty PA-MSR@@,ЍЁSR@SR@@@ 0^`p 0QP@p@-hh 0 S*X@  R 00Q S0 000 Ty p@-M`P@ 3 0P   T@D@D ,tX@ % ,00Ѝp$  bЍp Ty -M f  ЍP,@-,M`P@p L1PH W, ኧP' T@D,  BP Pt m @D`ᗨPPڔ _T@D@Dth@ }@0,Ѝ4 㓧 ,Ѝ\L 0 Ty 8@-40@T@D8P@Dt8` Ty 8@-@P 0 S0 R80 [0p 0S*  R 00QS0 0080ꐀ LTy G-8MtsCPU` |#P0S0PQ 00  0S 3c 300   0 S0,S2  Y"0 S*"Q0 0P^ S000峦 42R P0 "Q000Q Ѝ0! S1 Y0 P_ 000 S000,S+  0!04X1 `&0S P0!Q000Q Ѝ0 〦00u0  0y0StX`Ltt ! !d \c Y 0!4 PW ~ Ty p @-0@ = 0 T rmc@ @-@@3O-00PU4MbBJ P0S0P R 000"00SE [ p=\ W<  0p0p S @ U W 0 ,R4 [c 0 =n0S P0  R00 0 R 4Ѝ ˥  p\ p p / 0 Q00p0,S 0 R ,R  [ 0  0 0  0R | 〥k[ [  0ps$$$ Op  <\LH1/-M (00S 0 0ЍP  8 @- C@|A-耟M`Vp 0 p`0S0p`Q 00  @P}T0I0S TT p`0Q000Q Ѝf @-LMA]0 ,Rp`E ( R6 V1 10S-RN V  ? 0@#(@PB@0P@0 @ V`a` ?EELЍBT00  㭤0000 ,Rp` Vڌ 㛤`00 @000pV( つ LЍ萀 ~ @-`Q 0 S```0D!@T@( 4Q 00 1T0 ( T( T((OP @ O@ဤ6@ Dpp`P@ ZP@ lTP@ XNP@ D #N@0pꐀ p ~ T 0-M  0P00Ѝ @-0M T0 ,Q @ <00S  |0Ѝ  [ ꐀ ~ O-$M`D죟[  # 0S0 Q 00< 0 S@P0,S0  p㻣d#0\H#Q 00P^ S0 0R02 0"Q000Q $Ѝ 0 S  00Sg :S9  `P9  lxT"0 S*8"Q 00PR S0 0R01 0!Q000Q $Ѝ0P1@TPT0`p @TP_ UT0S 0!Q000Q $Ѝ000 0000 0\ Q0 0P S0 0R0L0d 0< Q\000Q T0 Ty p@-`M@TP 0 P@0S0P@Q 00 5t0l+I0S DD P@0Q000Q Ѝp  -M 0&Ѝ 0@-M 0P  Q  @0000CT T0 R@ D {Ѝ0, t00A됀 p Ty @-P@P $0S 0$0,00(0$0  T@Ty  @A-@ P- 0S $P`U PEU$P` '0Pp 0 0(0\\\ $PDLD <  $ AyTy LPxp@-@ 0 SPPP0x  R 0 S0P0`0` 0 Q0 P,R 0p@sꐀ C-Br M0P S0000ST9ԁ a:S*  _PI0S 壡0x R0 ,Q30 S0 0S000 0 :S  10P 0P  R 00Q&S0 00Ѝ0 Ѝ { l 0S*  R00QS0 000ꐀ ~ Ty P@-HR M ,PQ 420SJ 000,0 Ѝ,0S  BA0 S*  R 00Q S0 00 Ѝ000A`pc0p 0 S0`,S3 D100 R#10S7 ,`00K @^0\  R00Q S0 0ᓡp 00 ` R000p0p\噡 STy v  p xx 0@- S*d@  R 00Q S0 00@/000@/᐀ Ty A-M` P  P% Pl P& P| *P0SU(X 0  4ЍЍ b R XUP; @TP @Pl\2Ui pPp@# 0a)4)s1 (Ѝ z1 (00\P~vDATy q@DTt l@10Sn f 10Sh )@)Ta00#@P#TUw*P +U (N] ş'@$ <0P ( @ 0 CH ̷ܷp~ 4\ @-0M.SP`! A%@PD P% V pP- P$V 0ЍPpP0S V0 R )PV'#@ ^#@'ܱ@P$D00@ `Q( 0(@< G(~ h d  9A-@`p PΟX 0aA46O-0MS`  Ѝ F6 PpўP;d 0PS S 0284P40S+ 0SD 040080 P 5pR W W$W@P W6 W# %0 Ѝt5 "S 0SQ SR4 <彞 0 \@P@@$@@tP` 冠Z0  C? Ƞ ,ȠA0겠 0 ZR P 0SZX p` 0 0pG0CW` 0 J  PO`0` 00CS 0B0}'0Sx 'P@r' `R t3  S!@P R `0S- R"*'R@ 0᱔S 0S040&'0S ᰂ SR0s000 0PW  ` bP 0 Z *`0` { 00CZ 0:1@Z@ dP t0Pi0S0 N n`30 @P@ QP !N0N n10.0 H 㸝@ 0 0S SR040 奝V 㜝   㔝 0 0 0jS 0S0S S8R 04 80~ ~ ؁ Ty  , *  d@ܷO-sTM‘@ST` `#@0S0`@Q 00  K d0 S000,Sv @ D HX' % 00SR  (0S 2 < 0S `@0"Q000Q TЍ划0 S |20S 00SG 0 Sj D0S 8 R00 2Y  0 P@00"XR  8"Z08 0H0SФ\!0QP}Xآ ?; (Z0 0 S+ 0Y b 0 `pP# n  ㏜e ㉜0x00SW00 \ 0 IH nD Ty ~ x X~ $ "O-MYpxBxb  0S0 R 00 00,R S0000SfW8 㙐P   2X 0Sm 0P ,Q+0"S y!0S*  R 00QHS0 00Ѝ,1000pS0B0QCrqGqp R W R  F0 08 R 0lO R0B0C  )p 0S*  R 00QS0  00ꐀ ~ Ty @-M@ r 0Ѝ萀 A-Qp 0 S0"S9lA` P 0 PPR`$˔ 0 RQ  0 S(( 0  0aa\ 00 0`㩔 0  㮔x 0S*h  R 00Q S0 0`0`0ꐀ (Ty 0@- MP@P  YP ᠩ Ѝ0U Ѝ0A-`P M+ @qT0V0<,B 0 S000"SQ "0 S*  R0 0Q1 S0 00 Ѝ P#A!0\  R00Q S0 @P V``V A0 Ѝ 9``P PpcP 0ASOONNU1 St PMP0D 00S @0 ܓ1ꐀ Ty 8p8@-PP80S8@T8 @#8O-dd 4M0P \ppp<4 @ - @ ጀ_\ Ta 㙓#0\  R 00Q S0 00 K0<K |,0[S4@T h0(ß ,R00c0S T  R   "RF  R"0\  R00Q S0 00M⩑ቡ 뉁 p 8' "0 S*  R00Q S0 @KH0 :H0pSY S] S) !<K H ,0[S  |VHH!0 Si*8  Rd00Qb S0 X4@u0 #` Q ,Q  i  H ƒ( H 0R;Q60S01 0 \ 0*0 p0 ኒꐀ 8Ty p $Ld T- MP  Ѝp@-`PA   M P0 S000 R&"S  o0V 0S*  R 00QS0 00Ѝp~P VHvЍp000ꐀ xdlTy O-B$M㖆0 R002pPA 0 S000,SY l`P0 Y@5 P 4 hẒT $ЍOӑXi/PP0PK  0K$Ѝ12圡0S@ڀP0x!0᳒H嶒P`P0SD ő&/ 0 S000,SP& 0 R00  ᜒPP  㚑   0ۑXpX ㉑ 0~< けꐀ @ | x  0 S000 /᐀ @-Q @@0=S5 S S00@ R R p0S@` ` 0S0@`\ 00Q0S@`0\ Q000Q @Q@0=S@@0ꐀ  p@-@P0SRl 0h00 P጑H0"Pp0`0001C1  | 00S S/v O-$M@k@ x;0S lKl[d P H D D+H0 S0YpWz(˟0S* @q 0Sn HD R0 *jD0> Iʟ 0  0瀐0 0  Wl:  0pY 0 W W, W 01?Z.ʟ00W  P p pP \00S 00Q S0  p 000C00P k늅00S S} {:PtJ:Pp /P =P P P 0 =R^ и  ʐ000ZS  J000S0Z.S 0p 0p0\80SE<0SK(0S 8( S , [0(00S G(YI ' ǟ0 Pc 0pӣP  c0 RS U 0R帣P0G 00 0 0 0J0000:S Ɵ&pEpfL0PQ dƟ g p 0Ώp0꩏ 0p c P0套d 0 Z 0S Ho  Cv2 000=S W W=W # 0zلP 0: 0 S0e P( 0S% ğ< R3 $S $S $S* $S' $S$ $S! $S $S $S $S 00 \0P<0 `4 0 Z{ 0\p00003/ 4R 0|CS  4`8P׎ K0 0(0$0i$Ѝ0=Sy ^P0 P "00 0ŸP<0 3 0 j 0S l"0 3P 0后0  O  o V 20t z  p0Q  R 00PYS0 !0p0S  PX0 L f T g⁎ !p@^( P0 @   P j 0 0 E @p 000 p 0j 5X0 @p  R0, 0<0S Ty v ` h ̳P h  80d)(A0 x,0 Ty p@-M`WL@P $  0Ѝp萀 Ty @-@0萀 Ty C- MPP+ 602尀0 S @ڌp`/`0 0R0 0煍`ҍ@nP ;Pᥢ ЍQ |  @-=P`P 㫍p@᭍Pe P0 0奍$0  @  T x0H-@TP@T  nP0P῍ 0 p000M    oKkK p@-4PH@0@f@T@! ``py @-Q@  Jo0 a 0A0A8@-@P60)8@-@8/ 70 忌8@-P@  0 008@-D@0`P0P 000y hj00/8@-@P P8p@-@`6P  ዌ0PPpp@-@`P  |0PPp / P/! 0 S S/ P/!0 S S / P/!0 S SP/!0 S S ,S S S/P/!0 S S /P/!0O-p݌0 P0`(@T U@ o ፌ0(  P(P aD< @0()P @p @ ~ p  sPO-@LMPp |c,,P" h >TLЍ0:@@3 0 S`0,S  s$:LЍ,,,P,00 9 Sq*s T0r00nT0S 0 "0,Q Q00h20S dY Y DY O<<"<2 0 0 BP xPq  P   F E0SpKP `0P@!` ?``0 00 ? pW  1  B e r `"`  0@#00:  S P0   `0 R V V`5 `5:,M s( h ~   y p O-,M`ᮋlPP PQ LLH! 0 00 0嘋P@┋ LV"01\p30@: ো @ Up@\ ။ Pk  u   U @ p0ċT0s\\ P  ᨊ ,Ѝy $4< 4<A-Mp 0 S0@,S&P`V iP (넀`ᕊp }P mk @`jЍ $ ㆊЍ萀 y dH0H- MKK`00S !@ @@0M Id 49d/ K0v hI-pQlA4M@KDKphQK La@0 S9 D0&P;0D0! 0<K  0$ 0R 00pM< K` @0D n `<K0p0K(᠊@0D rM`<KDP @0݉DJDF0@  ꐀ y l4<tA-P@,0MSp` 0`00 $0㎊p 0|| s0 婉0$0(ЍH0s88 00,0T告Ky 4<@-@4MP `00p勊00000y`0 l$ Pp 0XX s0r k0p$0(04Ѝ!^y 4<L0@-H@M@00 40光0000  Ѝxv y P  @-@( (0P@Te @~  O-̑0! S M⼡@Pe R D0 S X!`@T `@T 0UUp2@40  lKR7p!L\((  b bQ 00 P0 00P000L0DD0Hp@D0 pS0 HH ЍOL܈ 0 Ѝ Q x  y xv P8@-0P@T 0q03P0S P ᆈP p0匈P0S 8Q @0pP8XPT㶉0 P08~ p 8@-P@G88@-P@>8@-000P 6 0 00Q~ x  p@-@MTPA $P Ѝp00S0`P 0P& P& 00 0]` 0S &$`Ѝp p00 0`0<0UB  ~  /P/P/Q0Q ! /0$ X0RP/@-0 M` D00lpW 00*S 0S PU \ @0@\ È0 @0rPU pW Ѝ @p p@-`\@ 0 PR(: ᯇ 0P0U( P (  0b bQ` 0 0 0b}L00Sp0Sp4 @000Spᙇ 0  A-@QMP` (` |pW 0  BR񟗒X TLD<4,܁ԁ́ā$0p`V ؁ ⸲P9 T\  @ PX0 Ѝ|xtplhd`\XTPLHD@<8400 0 0R P TP   0PtЍ0TP  0fЍ @ P0 mppp \ hhHO-Р@P(p 0cQ`0S((00aaP\ 0 0 000 A 0 㓆 0 hz 0p@-@ Q0 S. 1 پ`Pp ㅆ0-  0R @(  0 0 PPp m0 h0 0R @  @D    S  00\ hz @- @ T   #Q  d@ T T\T  Q R $ $ $\ @-0 00 0R   0 0$0\ =@-0 h00\  TP 0S 0S$00 0S$ $ $ R 0 00\ @-0 00\  lh 0 L00\  8<4 $0S  $0$ $0\ j0堾hz G-`MPp h!0 S ` A@0 00Ѝ@  `0 1 ( 0R Ѝ0S  Ѝ0S$ S000 2000P 00CSꄉ0 80 0R 00S`000\ ~ 0-lP @ T *0S00Q S :0/ dB!00/ hz 0 ąhz C-Xa@p P U *0S0G0Q S :U- 0S P 0@P00 eB!1@ @@ pp  p P(pP (  00 0 hz -lQM.L 0P ! 0L Ha 2?D1cA@B0@@ S@L p1G"@ |@R  p` a0W 0 * P0$0 P S :0 1?B!c10A000R0@ 0R BS0@Ѝ/0g00@"0 hz gfffz z PA-@ ,Q`P: d`( q R *(0S,00Q S :l0ЀS h `0@d`00A80080h0 `B!`l`Ml`hHd``q` h@_ `(p`@Z`0(l0h hz -aM.L 0Ppq 0N |Q 2?D1cA@B0@@ S@L 0DQ Cr@0rS0P P0 5`!X dp(@qT7*(0P, *P P& R@:% @1?B!c10A000R0@ S0 0R BS0XЍ/0r08@hh0DA0 hz gfffz z G-`M.0V`s`0LS Ѝ`0`Q @`@  @`A@00@DQ: Qq0 9 `a`00`F lP0 bZ R(( aaRd  0 p 0+Ѝ0p 6 0` 0- @ T !0/!0000/ @P!@  0R  0/\ 0 ,0 0R  /0/\ @-0 H0 0R  00S   \  x0 0 0S /    0   Q / \ 0 (0 0R  //\ 0 (0 0R  / /\ 0 00 0R  /00 /\ 0 8 0 S  $S/ 0P/\ 0 p 0 S  \ Sr/Q0   0, S  /  /\ 0 ,0 0R  /0 /\ 8@-0 T1 0R 8 @ 0SE 10Q \  \ Q $ T) PU$ 㡂P㜂P00S0P00S 0?S ?Pq8PU  8 00PU  $$$ \ ` @l p  C00 (0 0R 0p3/\ 0 D 0 S 000Ps/00 P| /\ p 0 (0 0R  / /\ 0 $0 0R  //\ 0 $0 0R  /0/\ 0 $ 0 S  /0/\ - M0 l  \ 0 R Ѝ00   0S  B Ѝ\ <C-@Pt(q 0c?Q9`@0S((00aaP 00 @ 0ԁ00 13/P 0 0 0(0ǨL00P 0@ 0 ; p \ @-M800S@(0( Ѝ` L0@- M@" p0Q  ` !00P000 00,00 P  Ѝ i\ hz X8@-0P@ 0 0R P0 d0 0R @0 <0000庨8@U @ P\ A@-M@ P Ѝ00 0wЍ~ m40@-M@Z 0_Ѝ~  40@-0(0@G0 0@ ~ O-DM` ? 0R ` !, N@ 0T$ !DЍ 0SI DЍ00p d0S0S nDЍ>p0W 0 P @СULdd\LPPP(0T Q8e @000P  0C0S T0 < 0R 0 <0S  0 < 0R 0 0 00 !`̟ 0(08 0Wn Wl 0 + Q  #10S 0P + Q @J #10S@ꐋ 0o l;0\ 0i T0S0 0n 0; 0Rm 0w ^ ; 0R @$A@l 0"!F :0\ 0@ 08 |:0X 03 xʟU$ U  P1 0ES0E0US\/ :0Sr 0ES NRaԥPdD,,XD   )0 S 0 Uv t)`S PL90S D9W Ux U @@P(0 0\ 8 0R @$A@ 0 ȟ!Rp|ȟ !!RpDȟ!QP  \  R ȟ P$ ^!ǟP!ǟ! < b 0\ \Q0|ǟR0  0L 0l20Lǟ!_4ǟ!Xǟ0  2#Ɵ!Ɵ!Ɵ !!Ɵ!Ɵ DЍp ~0 @6 0R 0 n@<00 O00]00 }-5 000 000000 000000 S P5 0R 0N 0P ^ 5 0RT  ^g0ğ0 S 0 000 d P 0 0^ |4 0R @0$A0@p00  0,40S $ğ$ Wp~ 006 0S! #%} 3 0R 0x s@ꈃ X $\J!H@@tP,#0 S (ß S Pr3( @ 0УTp  Wp^ 2 0R @$A@00`V0"0$ X  0! Rp Xp $p Rp0 P0@@@< XZ 0V  00 !}!qXQp 0$pd PGYD@1 R\ : !@ T  @T~(0  0У^  0 0R @0$A0@p00 0R 0wpG|| | 0X  R 0 00S\ z ~ LĊpȹ(\ Q 8< ⼧P 80H 0 3 0R 0 @ .0h 0# 2@0T T0( " R(  Ty0@M "0 S 0H P  2h@0/0S0 000 # 2P 24"0 S* " S X'  @S@P UT=* 07X000l! R 00000#4! T  `+  S  @D Sc 00Q 0u^70m0@˯ 0` 0  R@PᳯUT0 4 0 S 0 ( R000\  ~ l p x ~ ~ ~ (8 @-@Pp 0 1 0R @ 0P# `W! Q, #*0SR p1TB 0@00P `pU 0@0 0PV 0' 0 0R0 0 30 0R 0 @00P  0 `@@0 00` 0S 0 @\ ~ P 0@-@ 0 0R( ,@0   p0R ` w0 @0 0R @ @U0@Q @\ L0 0 0R /0/\ @-0 ,  Q 0 @  0\ 0 0 0R/ 0@00/\ @-0 ,  Q 0  0\ @-0 (0 0R   {$\ Z @-0 (0 0R   g \ d 8@-@PP 8 0$0S @P 0S 0 << T8  8@   @-0 $  Q Z0 0\ 0p@-`P@ p0 0R H`P`V 00 0R Pp000p P``\ 0 <0 0R 0 0 0R Pq/\ 0 0 0R /\ 0 L 0 S / (  R /(000/\ 40@-@[ɭ0 0@~  0 0 0 R /(/\ p00   0 S/ 0 00 0\/ 0  /\ @-0 @  Q 0   @ 0\ @-0 ,  Q 0  0\ 0 (0 0R  //\ @-0 ,  Q s0   0\ 0 0 0R/ 000/\ 0 (0 0R  / /\ @-0 ,  Q B0    0\ 0 0 0R/ 000/\ 0 $0 0R  //\ 0 0 0R/ 000/\ 0 0 0R/ 000/\ 0 (0 0R  //\ 0 $  Q 00/ 0\ 0 ,  Q  #/ /\ 0 ,0 0R  /0 /\ 0 ,0 0R  /P| /\ 0 0 0R  /0S0 R / d 0 S T S  @0 R 000  0  R \ 0 ,0 0R  /0Ps/\ 0 ,0 0R  / 0 Sr/\ @-0 $  Q M0 0\ @-0@ 0  Q ;0   @ 0\ @-0 $  Q '0, 0\ @-0@ ,  Q 0,0 0\ @-0 $  Q 08 0\ @-0@ (  Q 0 8  0\ 0 p@-@@@άlPl`ʬ@ buP0 HH08@<@@@D@H@L@P@T@X@\@ (0p萁 hz ~ @-P00 13/@0P 0  t~u p P @-0 M`@ t 0 u Qu RH4|dL4X@( 0HD3 Ѝ@!t 0( 0 0 0y 0s 0m 0gr !2t !t2t>t@0 @!<02t00C0r 06 00 0* 0$ 0 0 0{ 0| u0 hto$q 0Ps000U>t0 sY 6tTp0 !,t:>qt !t?0 s90 s3t/t0$8 H/L P(H< |`0p@-@P 5 0R 0 `Ve00`V 5R` 0|s0t s `s0X <5 0R @R 04%S S  0ds 0s0  0Ws r 40Q 0m s d R!P00|4Q p4 !hs0 $4 0R @  4ss>s00C0p@r3( R  0s( 0\s0z ~PPP0 N 830Q 0I D30Q0S  <0r 00 0r P00 0r 00ux2 Q |b R#ژ00`2Q p20S 5\ rp@9r000HR0q 1 0R010Q 0TQ0 r0~ 0 r0z 0 {r0 t  0srPo  04jr-Pj  0Lar@Pe  0,Xr_ 0Rr   0Jr|0 @r06 0  L00S 0j000S 0W00Q7 0\ t~ L (X~ @-$@$0 a @rL A-@Mx`Pp 1`\;rI 0!82r@>wr00C0ЍL (H@-@ @erp@-4@P ,厪 努 0p@ rhz (@00000/O-A威 `PlOU`P`@pL`h1P\(  (  0 c0cR41 0SP98(1 У @<P",H 0C@DK0S00000  00W(pQ(```(`( R P q  0qo  p z ؁ ~  <`p0O-SOM$H   E 00(0S@ `p(D0S "(!P1(0("`R#t04 0000S ( X@Y X@(cP2$ p4RPh `Vp (0(POߍA (0$X pPj (!PYX=    0Ẩ8 , Pp  opPU0PЃ ?R PP0@@a5#!p$, `p P" XX0c (80PX,,0p< Pp0@`p5q ֿ\ Cp0P@qp'q ȿ  6p0P`"p G-Mp  8@P`0 0`  0P7! ?Q! 0Pa 0S' 0lS00\(00(00 c0cQ  >0D0 00lS0$ opЍЍ@O-CሰDMUT ` 40S   ppP DЍ@P  $0(  c R 0 $0XD  0o$ %4 !$%8,%̠"4 <#c@@#Ƞb# a` _0^]\0@p P W; $,(`D0S "*!pB`T 00 00S X pp@TP0  00)P p0pW @ P(`$, p0$084 <08~Px0< ?4@P^$0n$YF ( $0lS40 00\@00@00 c0cQ$$ a(0$0 0lS40Dp00$ o딾X00P:E$0(  c R> n { 嗾t0   0 joPPdP 儾Voo. z0@ 0o@T\`@ G-\Mp`8 0S      0R  n 0@0@X 0boP@ :P X n Ѝ4 n  0 dp 0O- @MTpu 0S 60S[Ԧ `ȰJ4@ DXn$ P 0  0 0 $  廽 0S W V V 0  0@20SM ,0S^ (@T4 !PP# `P  P X X W 00C0CS X 0  0T 0   P@% 0S (@TЍЃl0X   0SԔ0 00 a0  P oP k,0S0@ BQ3!c0 B,, b3(,؂#  0 ؂YX 8P ?Z#lSRSD0 @0m00P cwPU P#Nl31jPv ЃB 0X5P401 00#S- S+ P P%P! ##  2 0  P0 00S d"S[P # 0PЃ000 0XP #!Ђ  0ЁX 0!? 0 0 0PP 0S LaP 02 0 X X 0X 0X Ѓ0 00XLtbD# dm {0 1 X?W ~ $)\ ~ x0G-Sp `V́0 - Y* HP D A> @PA P P . Y bP A6 0 0(`V PᦎP P @P) T T PP GmP  !0S  A  lX`FO- M 눠Z 0S X hs`D00C S񟗠8L@(00SA @P 0, lP  0 o}`p  0qlP WV:UT 0 00S؁`Vp@ 0@ 0" Ѝ0X0g00  o{00S A R0SR !J0}0@ P!P!ᮣP0;D`(F@P 0XH!AB(D`@_0 fkD 0 C0k  @Pg  zt o`|p ]p 8@4PDk 0 ᷺ 00@" 0 kp `Ċ NJFh]0C-SM' pW PP@ ` 0S Q 0(0``@T 000PD0Shhh 嵺PPPXP 寺000PD0  ЍU D0S  垺`z PC- ؁@ UTa@P UT0P0P ؁@ UTa@P UT0P0P4@  j 3O-MQ  0S (0 SX2` R  ` 0 `Zk X} A0 A ?TX !pP3 V' @UT"  `!@SR* P@P  0400Y `D q @0 (XV Pp V0@P  4 100w`VY Ѝl @PD@%j ᙹ  k4  0 ЍO.jg p p@- MC8`<@` ЍpO-`0$M0CHLpSHt0XXXXXXXXXXXX 0@ @p  Y$Ѝ 0@P 0 @0@0 P0 @0@ C0CS 0S q3//8@-PR@8Vi0PP80P/\0Q\/ 0P\/O-410lX$$q$@P0S2 `V.P % `0VA  RP0S 0 0S  0 [P  ᪟ X Q\  [p ~  O-,MP)@P|  0 Sl  R0 p00 S l R0p0t0P0C(@t0HP$ i 0 0i,90S0 `P 0 $Pi $0S (X` `i`@T m&@P i!@<@ `1< |ȟ 0RX%zSO0SK S? 00, 40h0  [&  C0 a0B(XU  ,(0S. S`p  0P4@hh ۷AP`'[TH7 @ P0S[ P @`pT 0SP Y @Y t&0Y l0Y `pS  li d i86@T[ 8fvP PPy@PM 0U0P Ph%ZPP VKP [P NPP~ BP8P 0LS]00SZ0SW0ST>0S)00S  gꒊ̶P ,Ѝ@`bm Pc$0S 0S 0  U  ^ @PKD gPT  g 4 $UT 0PrP  hg Ķ0T^ YP 0S P PO P PP%VP/ 8gᙶK"2 0 0 0POl"PU @@P 1!P$?g8r "ȐGG`@   vPT,   RQ Q Q 1QP f!1UT 0 <"QP0 00gP\\\!zX1 ֑  @g81 0S $ g  g,Ѝ fP \[P0PO #PG J < \ p ~ LP Xz l tX d, $( 8 X` @ LO-TM,$,4 $`V2 pB!DAⰄB Q񟗒|ǎ0`pVS01@0p(pDp$X `p0aB0@؁ D "00LB0(` 0$ Q񟗱     \    \ (P ,u0`pV0`Vp H"@?P@P @T PQ8  0SR@3P31*0`pV  $@!!0`0Vps0`pVj 0"0`Vp`( eD.7C!ԝ 408 0e0  0!Ἕ@TPV TpQ\ h 4P8@e  ( 0 ZKap6 (0`VZ @ppW@p7@ ie, 0@_ aD`p \a \ ` (0` 0@_H B0@PP,  v0@_V@P @P0a `p@TPT4YDդ 4P8@e Ꮄ؀0`V paHD00 3@ @P?` pH0`pP `VpZ 0SR33SR`3p3@P@TPT0z( (0S,0 $ 0Q@00@000( $0n$0nP0$ 0 X d XXd ؀ 0@! ``p!aD:᫜` $ 0 C`"8L `L c0"L 8 !!3H0pWV 0!dB @P00# 0XB0 0 bdD!1(pp(p 0(0 ap( 0p(0 0pa0`pa$0( 0((0 (0$`@`pPP X00 P@P@ P$Z D@$ QP@ 0\D@DTЍ4`V \ 4P8@c >(p0xp0DptĊ`H| 0@-S@0S oP00@-Q AA"Ġq `,#4 c`@-Q "$P,#4 c` 0 7dz Pp@-Q`@M0 `c 0$dD0@ d0C RH0KQ W dl 0 d8 0Pd0`*c00< c 0 aS  0c >6d0S  0c>(d Ѝp@#d 0c R c0 0| wc0 0` oc0   0<gcL \dltl0 /D0P  /  /{ /0$ &$ /{ 0$  &$ /{ 0$  ($ /{ 0 $(& $ /{ 0 $&( $ /{ 0$  &($ /{ 0$  $ /{ 8@-'$@ RF 0$@h'@/{ [@0-'$P RVO0$Ph@('0/{ 0 $ "$ /{ 80$  $&(*"$ /{ (0$ #$  $ /{ 0$  $ /{ L0 ! /$ "2&*$ /$ " 2&*$ /{ 0$ ($ &$ /{ $0$  B($ /{ 0$  &($ /{ 0 h /{ b0 h /{ c0 h /{ (0$  ($&$ /{ 0$  ($$ /{ (0$  &(%$ /{ 0$  &%$ /{ 0$  ($ /{ 0 $& $ /{ $0 $(&  $ /{ $0 $&(  $ /{ 0$  "&$ /{ (0$  &(*$ /{ (0$  &(*$ /{ 0 $($ /{ 00$   ($ /{ 0 $($ /{ 0$  (&$ /{ (0$  "&($ /{ 0$ &$ /{ 00 $p    $ /{ 0$  &$ /{ 0 $(& $ /{ 0$  $ /{ $0$x $ʠ, *"h$ /{ @P9 @QS B Q2 @Q,/QP 5 Q' @Q# /QC 4 Q$ @Q / Q6 @Q2 Q/Q* @Q& Q/Q,  Q @Q// /@// /Q/Q /Q/Q ///// / // /0SS00<S S00 8SS00PP//@- @\PpPR\p` x U7@R RR'0Sm 0Si @P@W`0S_ <S4 8S\ $Re ("(Q\ #88S` $RI@0SB ,RK $S@@4>7>S~4SW R0 0S, $<0CL@$D@P  0S 8! #7,#00tD*J"  00@@$H@$D@ $D@ $L@$800 (0$   $/{ a0@- c|"R#0 S@0 cq"R0 S0Q2H \ P \   \ \ \  $ \ 0 8 @ C30 s ʌ@/  0 0   0 p@-Q@`V&pv@P _ _ 0 S p00S  z_ v_ 0S plS`PT j_ f_ 0, S 40s$ >$0 p{ 4R@- R0P$ <P( 8P! 4P& 8#8 S  9_0 R 0S <S      `{ 8@-@PP 0 S  U  _ 8U 0hS  \^ 0H S$0 V$P80  R $ 8 ^{ p@-@0PS U `U 0Sp  R$ 8 T^ 0@ S$0 V$Pp, ^ p ^ p{ ܵ@-@ 0  R  S p ^  \ QH ^  \ R$ 4${ @-@!0 0x$ S $ 0 $ \  Q! Q00 $t U^ ` O^ 2SS2 <^ { <T8@-@ 0   Q  Q R  #^ 8 S ^ 8$4($ dP 0 R X0 0S 8@$"00$ h08  ] 8{ ]t@-p@0  Q S P ]  Q R( ] $ 4$0{ @-t@0  Q S T ]  Q R, ] $4($ { @-@$ h0 S "S' 0 P S ] h4\$0x 0*2+7 $PT0h0 H |] P?h0( s] { #@-@0 R S  \]  R Qt Q]  \ $4 0@0#  $  9] { ܶ8@-@0 R S#  '] 8  @ QP$U4#  0A0$8  Q R, ] 8 \ 8{ ܶ@-@0  R P QXX \ $30 B0 $  \ { ܶ@-@0# S$ S R R $ 0&$ Q X \ D \ 0 \  \ { `H@-x@0  Q S X \  Q R0 }\ $40($ { @-@0  Q S ` d\  Q R8 Y\ $(40A0$0{ @-@0 R  S x =\  P QP 2\  P R$ 4${ @-@0 R  S  \  P Q \  P $ 4$ x0R  30$ R [ { <(0 $ $ { 8@-A0  Q S  [ 8 Q R [ 8$P(40 `$8 0Rh0'8 R3%Q0*0$84 [ 8  [ 8{ <T8@-@0 0SQ P Q 0S'P $ h0$h08L ][ 88 W[ 8$ Q[ 8{ `@-@0 0SQ 0S' $0D0$h04 *[   $[ { 8@-DA0 R S $ [ 8 R Q [ 8$ R*,P SQ P P >+B! P 42 $ 80\P 0S P Z 88>+B !10$08  Z 8{ ط@-@0  Q S  Z  Q R Z SR ,Q $t>A10$0D@P $@>A4  $  Z { @-@ 0R  Q S  pZ S R $6("$  Q R, VZ  PZ { @-@0 R  S p =Z  P RH 2Z  P Q$4($ { @-@0 R  S p Z  P QH Z  P R$ 4${ @-@0 R  S  Y  \ Qh Y  \  \ P R$ 6($ { @-t@0  Q S T Y  Q R, Y $4($ { @-@0 R  S  Y  \ Qh Y  \  \ P R$ 4${ @-@0 S Q ^Y 1S ,0S S $0 >;C10&.0$h 0$0l >;C0' R0P$'hQ$0$ > C !`0${ r0AS@- P LA06H 0S006600Q9:;(;L;p;:0$ @$0$  $0$ $0$ $l0$ !@ $H0@$ $,,, 廨$ X 0S { P@-(@0$  06$0{ @-(@0$  06$0{ @-$@~{@w{ 0r{ @-$@li@e{ @-@_@[{ @-@U@Q{ @-@K@G{ @-@A@={ @-@7@3{ 0.{ @-$@(%@!{ 8@-\@\$0P" !40 P$0\  $0U<2$08$0{ @-@$0 6$0{ 0$ &$ { @-@@{ @-P M@P `H P& P !`p0000PP !PpTP @PUTH Tp Ѝ8`@p 0   0 1  1S% 000`px 0   0 0  1S000000T$$ Tp ЍP H~  { 0 00@-@S MP, BS T S H S \ ,@`,000 P?W Ѝ0~ \ ~  0A-S0SpWW T0`XVp  QP *0pW0Q @ `UTP0S  0ꐁ O-`0,M0CPpS6B C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C C CW  W@P  00@T  p  0P00H0,Ѝ@T P p  @0 ~ { @-FP 0 1{ @-  V@-@-  V@%8@-  V@\@-D@0 8P 02 0?h0 V {  @-@M@P# H2 S  V  㓇0S SR T VƵЍL2sL"Ѝ uVץ{ ع@-\@@P H2H S @ aVå0L2L2s VV븥{ @-(0 R  @Ю{ ~ A-p'>@`0@P\"2` 0R2pXP` HVXUX2\"0`&dSl$DP\R~UVX{ C-q,M@P`  0S 0 0 VbB,Ѝpa0 S  0,S!@P @ 0S qM@P 0" 0 S0 ,S P @t TN,Ѝ0 0徆Y 0 S T U,Ѝ8 U ( U{ T p'C-@ 0 M  Ѝ,0ROTP$E0@U 3<à << 6 0@,0RET9@tPR`plVp X0, 00"#da LTP0@P@TP$!/E1@ @@D T ЍC@TP$E ? AOTP$E{ p@-0P%S0 `  ` 00 0 @00_R ,0 a岍P@ppp{ 8@-0@(S 80S)S ,S ,S P0)SS)S 40 a劍P PP88P{ C-0 MPP`0g .R8q弁 W d BRH0MTMMTMTMLTMTMTMTMTMTMxLTMTMLMTMDM UPP@ @P P90 \ゑ@  .R \3 00 Ѝ0000 @00@@h dT0ģ Ѝ \, TTᵣ̺@-@0S $"0R$0 0 X004sQ@0h08 ,TD0004s{ Y@-4@0S $ 0$0 T*0{ @-@0 R  S  S  \ Q S  \  \ P R$S 6($  S@{ H@-t@0 S $  8$0!$    S΢$0 { hL-P pP`@蔐PPPPp`/{ G-AaPp$堀Ȍ$pM ! DZN P$0Q 50$00Ѝ  YFZP$0[6 <$0'>h0p R 0SP R ;$00 ! \$P  Q 0P$P1h0 Q  Q  Q  匡 Q  Q  Q | Q h Q T Q { <мhlP%4<P0$  Ƃ ${ @-,0Q 0@~ ~ @-p`@T2 00@-0 @0@T 00P P ,QPl0`"P @R@8 XQṠ0@@薰ꐀ { @-p`@T+ 00@&0 @0@T 00pPpP PP L0P@R@譩8 Q0@@\ꐀ { A-q`@Tf 00@a0 @0@T 00zQP1H QP`)0Q0P- PP1"  X' ! ``a"Pp ƒ@AN P0St P0@A ! `!ꐀ  t{ | O-P!1唑唡pQM@IPP' d QPJPQP  `XP TP  0 W000t@ЍP0 0P  `6P0 1P Z   0Pp 0 `>P域ЍO}  0P0 `x`~ (@-|@@P H2h S ` PzPPp}P``H@蘨L2s Pg{  @-<0g녨,000 Rt R  t ~ ~  8@-A!0P) $ $  Q*$$ 0$$6S8:#6("S8 O8@  U$06$0X O 8HHH ]< O 8, O 8{ @p<P @-a0Q01 @0 03+01 p 0Q/ 0S, $0$0@$0S $0h%P$ @A@5$0h0h0\ [O P0 4 PO  JO { nhG-qA`a0吀0Ss`PI0% 0SI Z  D$ 0!$0 @P5A$0 0#@  R$ $` "$ $ hZ 0SY$ 000S 1 h N \0h DRPQ0@$05$0?h0  N { a h@-@0 S  S!   Q Q lN0 $$60$0 @'( N  N { H8@-LA0-  !S= $Q) R   QP& $   P, P) 6$08@\  pN 8 jN 8x eN 8 ( \ \N눝0@ UN 8 ,ON{$ 0{ |THP @-0@s 0嗝 ]{ 8@-@ $0PQ X VP0$080S 0S h N\P P00S 0  8 N.$0$ M 8{ L x(G-QpP $ x1"RK0 S  WP T M D1$ RD 8A `$D0S ,@T$0v $ኢ$0S0S0 S 0 S mP 0S  0 0 lϜ  W@ M W  M{ D -P0 M p @P`P`PK / `P @@@K /{ A-p@T; 00@60 @0@T 00`PPU LPp0.2yM2  0 0@ A豥8 !Mႜ0@A_ꐀ { A-Tp@TO D00@J0 @0@T 00aQPU LPp0.\2 ,M2  0 0@ Ad| L50@A0S L /000S02ꐀ {  p@-@Pzx`LPd0 !0`p@/HLP400`p@$$ Lp@ꐀ { @-髢P@P*0 ,QPp 0T0@S` WCP @h dLś@ ~pP4 VL븛@ꐀ ~ ~ 8@-@0P'  R0,R0,P R \ ` $0( $80$403/84 !L L 8 { 4PF3H0$02 S0r0P S$ S { LD4<0@@-PS\M@T KT PX0A 0TR  K \ЍpT KTX0AT\ \Ѝ@`@p`p````` { T`@-@$0 0 @h0S1 0 l@\d@Y\@VPH00S < KÚ( K {  H0$02S0q0P S$0 .S *({ H0$02S0| 0P S$ S { P ( @- 00@ @{ 80@- 00@ @{ H@C-R`@v Tt 0 T 0 @ P^ q嶃Pb RK̓J P JJK0`SX @ 000Sᖃ(1P  㮃J P JJ0S F 000Sz0pP  㒃J P JJJ0@CPp  J0@CFL J0@C> ( Jꐀ { PtO-@xpP@K` ,KD0P :R Tpq100```@-(p@P`;" 0U! BBP T p0@VT DL\ UPeaPaPePU 0T  0-C-0B M0(P```,(U* papF0@\q W 0 R$wxww(wvv!!  # P(U h J 0T!S(P  ЍCЍ/!!  0 S !! !! 0 SS110(U 堐 #   堐 #    堐 #   0{  -0@-P M@$B@ @ Ѝ0@Ѝ/ 0@0t  QP 000 I 0 S  Ѝ0@Ѝ/{ 0-$`Pp @pn&xYeAXP@P @@ Qr  boR` @*P\$ "$$ /{ 0p-@$P` PnI&XEP @@ Qr  boR` @)P\$ "$$ p/{ @-(  0  P~@G-M0`pVPЍ0AU0#"0? URS2#  H 0Q 0  $ )0e  0V ?ol` U0c0W0Ctp: Pp\ t rt$pЍRS1#{ p@-+B !$ /$ >+B! $ /{ /00000/00/00/ 00/@00/000p@-PM` @,,, m  ЍpP1 -QO-\M ş0 0<0< R< 0H@ R !0 S5 0XP[l5!!0$ (0,0S~ 4H0`00Q1040 0S @p$ 0 R @ $ R @  $ R @ $ R @ @ 0D00D0 Dp  D#D  D D@ ID@X@@p0DSn Wm Wn Wo @W @0S  (P $ 0 0!sX#0R0S3  0`V00S0x , 180[a  D " 0S  0 \ЍOЍ/@@@,(0@00@D D0@0TD0W t D 0 82R @ @ @ @0Q<01 0XP [ 0SW  |QP0 S P[ ! `a0 0`P0pX腁 U8 !P U 0 a 0||PP R0 11`P" p `qP0P U |0`S 0!煑~8Wx}pzhwd 6D 0S Np(@,{  { ""DD0 8{ TPp@-@M` P( 40P V0S 6/ЍpPPP ( ,004P > 0P3{ p@-4M @0  )00CS $P PΠ,X ` P  P \4\4$0Ѝp24$ C 0S Ѝp{ H@-M( ^40@ P 0Q $1RQ$$P`` ^%h ɠpU Ȇ` ``R vP 4U3\4$0Ѝ24  eC Ѝ{ O-pP0w @0PRM@TTTtPWpD\\P 0`V 3 Ѝ@P 0 ~Z 3 `Ѝp 0p`V 3 Ѝ 0bpWP3 ` 0U`V3 p0P IX2 `rAf0` ;PU2 0p /`V2 PAVl2P "0SP2 `D2P 0S 2 20 0pW 1 w10 0`V1  pjs0p Yl1  `[da` 0Z81  Np 0Y1 B` 0Z0 6 0Y0 * 0Xx0 0P 0SH0  0P0S0  { @ @-XM( T @BDDD D0T$ (0X0ATP XЍ@XЍlt|h00@-$PM\0@ 04SWTP U,,Ѝ0@UЍ0@{ @-M( 400@ 3TЍ@@-M( 0004@ TЍ@}@-`MP( pvdĠ 0` @ 0R $A  W rP~ A$@\Ѝ@A$ 0"PP !uA {   w w@-M( +4B0 @$0A  0PsЍ@@-M( 4B0 @$0A  P| Ѝ@@-@@-M( 4D0 @|(0A  P~Ѝ@p@-M( 4 @ c$0A  @PtЍ@@-M( 4d0 @HH A <0 PrQ~@ @Ѝ@d{ @-M( 4P0 @#40A @Qt0Ps Ѝ@D@-M( y4P0 @40A  QrP| Ѝ@%wO-PHM0 0S4 0,X0S Sc$0(201 :0( $\00`S(`4p $ "40S SY S= 05 0  A0( dWpd 0200S S$ 0g0?oW0c0(`0C#b`0 (9 8 00 $0VC l  Q 0  R4=3$0Ѝ$0&201 :0( $\r4p00`g`ooW`f`S(0$` &"  Ze  @$`  @ $` 00$0%201 :(( $\<0| ?(0S 0#20 0C4S  S @S  0? 0%S  ? ,$ a /oQ b  0 B#20 00$ s,Tda ?  ? s@$0w $0PZCĠ:  W Z Z 0@ 0 00   ( 0$$p| (0S W W W $0` Y0k0Kekx d? - 0  0( p$` (0S W W0pp$0`  20Sf00s" 0@ 0A( 0yp' 0" R$  ꬀ 0@ H0 00  ( 0Zp 0" R$   WX(` b0#2C  \0g0?o 0cW00C#` >$` 0  0  0@P 0 P( 0p (0S $`` M0PI  >$` ` > $` 7` > 0S$ @$`Q` >$` B@\ { P.>H8 T@-M( 4l004 @P0P$ A D"P !~A  $@\Ѝ@p{ @-M(  D00<0 @,0A  @PtЍ@@-M( D004 @}(0A  0PsЍ@@-M( D004 @b(0A  P| Ѝ@@-M( d00\0 @GL AD0 \$ ̠P~ $Ѝ@@ { @-M( d004 @"H A@0 \$ @Pt $Ѝ@sw{ @-M( rD004 @(0A  0PsЍ@W@-M( Wl004 @T D0A P| Ѝ@: R0. $ Ѝ@p{ @-\0M0 H0D0D$ 2,A $@\Ѝ@ { -l0M0 X0T0T$ " !!P  $ \ Ѝ{ @-\0M0 H0D0D$ 2,A $@\Ѝ@{ -T0M0 @0d<0 $ Q~ɂ $Ѝw{ (0 \R$ $ 0".$ /{ @-pR@`PU$P80V``0U0\PP$P@TUU P$80$P{ XC-,Mp (0t(P@5 QP 7`V"0 PU)Af` 0Y0  0S x0  0\  0,ЍC,Ѝ40 P0 `,ЍCy{ @-@$0#, Q $ BQ8 ɠ> #(  $@Dl E<  Q L@Q <@4 4< $@@{ 0@0@-|AM0 ( \104 Pa$0<" U!4 !20 $0\ Ѝ0@ ( 407 PD$ 26S 8S $ $0" U! !20 $0\ Ѝ0@ddd 彋!20 $0\ Ѝ0@!20 $0\ { PB4`@-M( q40 @h0h$ T " $ \Ѝ@" $ \?Ѝ@{ A-AM0B ( @104 ` 0PcoSaA q%2p# $P 0!84a0) xQ `Q Pv 0P\0 $Ѝ ( 400 P$0201 aR\e R `X Q0 $PR!  u *0$0ЍA{ p-@$`PppY`U(x@ `#S@8C7PR0@  8P0 Q 0R\0 $/{ @-0M@0 0* 0R ڣ0S*` : Ѝ 00 $0Ѝ@G b  Ѝ{ D@-0M@0 0 0R ڣ0S*l : Ѝ /0 $0Ѝ@8 b  Qr zЍ{ D@-0M@0 0 0R ڣ0S*` s: Ѝ -0 $0Ѝ@* b  MЍ{ \p@-01M,A0$1 P 0U 10 0$02 !Qp 0P $\ Ѝp$0 201 0e0n?oU&X0c0  0CP9\4 24$0Ѝp{ w0-0SQA 0 T"\DL p0| 0/Q  0@t"|PdP 0/ 0Xy 8@-PH82-BC` 2c@_0/@-p@0 0` SSS Q  @0R /h h00 9 { *94004s$000S ! {  004s   @- A0, 0($&S "A Q# % &&0 $00 68$00 $ 0D B9 & &60&".$ { @-p@Q 0 '$0 06$( 9  9 { @- @0S 9 { @-<@0 S $(60$0 8 { `@-l@P00c P $ 02$0S0 8 S 8 { <@-0 @{ @-0@{ @-0 @{ @-0@{ @-8@0 S S @l 8 { ` 0 $ $   $ /{ 0 $ $   $ /{ @-d@` 0  S R Q $8 0 $  f8 { @-x@ 0 R  Q  STT S8 S $(40,$0h C8 { _@-@$0h% x P p P6$0T x :2$0"P0 8  8 { t@-P@0  Q $ B38$0 7 { ܶh0@- \@   00 S $0C#8$0 7 { ܶ@-H@0  R$ B38$0 7 { ܶ@-p@x0 R $  !&088 $0h ( 7  7 { <@-h@h0d 0S0 S S @_0 7  7 { `@-l@h 0000S S S $@0 Ȁ$ d7 { `@-p@0 S $6$$ S  ( I7  C7 { `@-@0 S $ 60$0 Q @ &7 , 7  7 { H@-l@0 0 S$0  80$04  6$0  6 { 0@-|@|0x 0S 0S $&$ 8D $0h 4 6   6 { o@-t@t0p 0S 0S $ 860D $0h 4 6   6 { ox0@- $   &$ @@ 0$ 3$  6  0h0{ Pap@-T` p0Sp0Sp'@P 0p m6 p{ @-L@0S < `6 0$ 860$0@*{ @-L@0S < H6 0$ 860$0{ 8@-t@P01 $06 8$00PE0$ U00$080$0  6 8{ @-d@010 $06 8$0$0 0$0P$0  5 { PQ@-00R R @R0  PQ0R    嶅 Ƞ,ȠP%6pC- ,M( }401 p `0V0$PM pA$0 20@000U05E⨂` 0p 0.$"(q"  95 Q 0| 034$0,Ѝ 0|3h 0p\ k5 0S @ c5(0 ,Ѝ( [5 ,Ѝ{ DPp@-@0' ( $0 201 1``>#hP P   4S0~03 Q\ 4 24$0p$0( 201"0\0$ Q$0{ A-8M P%'& (0p `$@ P $ (0#0p`@ !" 0@P!SHHHHHHHHHHHHHHHHHLHHHHPT44D60 400 5R 40@St p XE\0 ƂnΌ&Ȍ#2(Q $3Œ00R | P\3 4$08Ѝ6004 00DS0 040 p D4$0 0R\0$0 2dPD0$>'>R~$R#, 3<09D0 0R  _4 C0 U4 Q4 8ЍC0 3$0B0 $  80PC0 0R 0P H8ЍA<8C400( 3`m4P 0e0?oU0c0p0 } P @k R*U UPxPpGW$$ &2&0`8` 02%QZ$PR$BX20( 40`54P 0e0?oU0c00p B W_ @k R_*Ue UaWppHx$$ &2&0`8` 02'qz$p4 l3 0 !S  TTT!千P1$0$ 0 0 00$0 U 9 U 6@SP`pp` 0` 00000G s3  m3 pWpp{ 4 @ p 3@ DP< P 80@-M( @004 P 0\ \ t 23 Ѝ0000Ѝ0@D Q $lR ~ @QtЍ0{ p@-B MPPU U) ( 40`2 PN0`S$0 20 4!! @V$\Y 0CSQ( 401 P$0`S$0  Q4  2 Ѝp  jp H!0Q $$PR9 u.8 034$00 \0$0R4 24$0 Ѝp  1 E2  w "#  R  ( ?4 `T $0a < 2`P01v0 $\0{ Pu6ﾭބ00@- M@@P#AQX S2뵁땑Ѝ0  Lc0S00Ѝ0萀 Pp@-`M@P p   h -2돁oЍp@'Π@?P 0@ ᩊЍp 2z{ d0Cp@-`P@S&dddddddddPPPPddd4 v20S PpT 0SpR 0S pp@-@P` P 0S 0 0S 0p`pppA-aM@PZ |Q 0 S0 ,S@ H 1Ѝ$  ptp 0 S0 ,S00 ! W 2W  1Ѝ P R?B Ѝ  p  W?  R?B Ѝ c1ŀ{ p@-HAM@PI 8aopP8 0 S0 ,S00 ω0 S" 2 S  91뛀 ?  R?R Ѝp  p 0 S\ 1{Ѝp @14rRЍp$ 1k{ 8@-D0$  Q $$  0@{ H@-x@ 0S $ 0$000S @ 0 4$0(@  00{ \@-@$ 0S $ S 0S 0 0@ 00 { H@-x@ R 0$00 Q8$$ 80 ( 0@ 0 { @-@+0S &P!P PC-a@1Sp1 Rp0 # B R00 0Q0 2Aa0 S"6W SF P P@P P:000R-0 # B R200 0P0 2 a0 S"00 P00 Spp/0 ``` \ / 0 0 /0 { 4P  O-̂,M(p0` ' {RL0P 0p@g [ U}PPPU 5` @ /P~U   /~U 0 ` R  0,R0 0  0-SKP {/~ P 0S( h@HTKp41h0@ 0|S+S,0 0 X/0 ,Ѝ O/0 R ,Ѝ!@P@PSR@_`}S x ,Ѝ 0b @B, $/D;~ 0 / { <pe <O-LMH@p<$`PP XV XB XX X[ [G 0SV 0 0 00 .R Pz@0Sz  .2 R  0 R  0[R7 V  Y00LЍ0K0S .1 R 0LЍ0K0S0K0S 0S 0  [ h .P1 R 0 0A Q  ]Q<  00S 0 R  0]R0( 00$ 0    0?p  V0   ,0 0 j{ l, LC-P M0A00`p0b 0 0PX A `f0P` WIddtXN0 R00W2 p- 1 `a 0 0 00㦀  ЍX10  -0 X  -0  mP 0ppp } d-@ 0 L -0 0 -0 { p{ P@-$M0`@ 0<0S9 S42!>"!R,ARP0AAp 0 @  00$Ѝ0 C(rQ R  0R\0S:$Ѝ!0@P@P 0@00, { 0@-MP @ 0/p0 (Q T Ѝ0 +-0 R Ѝ0{ O-0M0 {\ J0R0 M:R002 @  0pP Y0S`pp0`X4 Z. @0-S1 S  0,S Y 4H0  0[  ,1 Ѝ   0,{0 0`pF Y/0SPMPP   0e  P@0R y R  &&  s00j t,0 R  Ѝ0 14d` 0!4 0Z,0(  ,((( 4| { P8xPMC-h@@$MP ܈00 {R00PP P 0SdL 0D <{R0pP0$(p7 @@7İ t0-S S0 ,S }S [?@ 00 @PS?  @l|p@i j2\ " RR L70S  03 Q ' 70W A  0  x0Q?   0Q $ЍT p@+ ,0SpWpGpPpT LH&@{UPE  C A ? U  y+z뻊$Ѝ0 崕{R0@p0pP 4X E0-Se S0 ,S[ }S ?   0Q\–\ TX" 0RQ 0S, R 03?;@\…P0`p U U 0e0C< 0PEu`F usT +qzQ$Ѝ8 +z  +z    p UEPU 0  p Tt@T 0t *d5zX00 QP   ,Q00]  *zApP @0S2E 0E  d  ? ' *yމ! *yWpWS0CG202  DPPe* R\‘PJL' 0JR\  q*y볉   %  0 0`[X@pDW  Q*y듉  OӂU  @2   ?  2*y!Q !`S\ RHb 0Fp3 0QP   "6 B0c0L@\… 0C { P(PP8pA-M0p\  ` Q`@ ?T ? R0@Ѝ ) 0 l`{ 0@-$M0@P 0]0Sh0QQ $  $Ѝ0$ )0 $Ѝ0{ G-@MP \. [\02   R00p6 qxg ! \l ,\07 :\ \  0]\j  d)0 Ѝ00[\ \ =\ &QQ    P 0Ѝ0  Ѝ ! +Q00 -Q0@0@p[ 0 \  0,\0 0p 000,\ \00 R !R ,Ri Pa0@` P 0P'0Ѝ01   !R R 00P0 b0 R 0:R  @sX 0#S :S 4p LPc0S'0 S0#S -S !0@!00D00100 R00 {RE  ! p(}+Q00 -Q0@001pH  01  0 S  0,S^0 0p T E("0 0C@ 0 x"  x 0>p  0 S0 }SG  (0 @䁟@ I0 p P0S'0 S0#S^ -S0c# @ t '0 0:S@ Fp p P 0|Pa0 #20 P o  '0 h ' Y :Y 00h0hlP ' 0 S0ddd \w 00h0 0 0h00 S0{ p{  { pLPDA-@MPp" qqऀ00 0'夀0 S  0,S Ѝ 7 Ѝ P0 0 S0 ,S 0 h   P0PS0SQ'SRAQ# \ 3' < *' $ #' { p{ [ 0$ &$   &  x@   $/ 0\{ @-\@$00S $Œ0ƌ$ 0@F & { @-H@0 0 R S$$ &  @<{ P@-@ P@0S( 00Q 0@8 &@vh@0S@ T 00@#@ &u ]  &u{ ~ ~ h8@-@@-0 "{ @- @~@-|P@ P  b&@u@A-~l@@RU \ Q&AuQ넂 0poϠ \RDRHR儂Lr @{ @-0@aS 0rS 0mS0S0%P %P p%0PP 1@0 ! 8 &mu 0 ! p@-\P\@`@T %P40 p %IupXP Tp@-\P\@`@T %P40 !p %+upxh pp@-\P\@` @T x%P40PRp % up{ @-@ 0! #2 N$04$0P % @ % 0 %  z% { @-@ 0!  #2 @P \% @ W% 0 R%  L% { D@-d@ 0S ' ($0 6$0@ +% { d@-d@ 0S ' ($0 6$0@x % { dP0@-0H@S 0  ,0R$ ,$  $!t { @-8@0 S S @ $ { `@-A0#!5 !00 " C r!  Q  R $  x@h$( !!!$<#2$0OQ 0 $   $ { T0 # $ ($ h/$/1{ [8@-@S 0S t m$ 0S P\PPPPPPPPPP803  88{ @X`8@-P8 A0 R S ?$ 8$ 4$0 P * R  -$s$0%"!!"XP0$08! Or\ 08!$8( R 0 $ 8  $ 8{ h8@-P8@0S $ 6$0 P  0$08P( RUX @ # 80 #>s$0 # 8{ hC-`Pph\@P P0S0S| #r## P p @ @[P s{ P^I-l @$pPPK<1@#\PPA $$00M 0ᣁ@a U#q P# 0S F 000S `$P0S F 000S dP$P  xK qP( ;#fr{ 8@-@^PP T8 g#0 8  #0 R 88{ K-hM0 xKt p0 w0K@ $P  $PP0@S@ KPK@P 0Sf 0SD`KD`Kx0KKx[pP $0SxKbt0K Q00 [Qp S#00M 0ᣑ`q i#0X10[ 0p S  000 0SP #P$0p S8" 000 0S #P x0[Sx0K Z "qKx0[Sx0K I w"q w l "`00M 0ᣁ`q #01x0K  $ X"qXK\K L0[S  K"qKx[ T0xKw0K0 S 0 ]S  7"q7 2"q2D`KK 40[S< U 0h `0 l@K4@ "}qX` h8p@-`(@PP tPp(rT(Pu@P@P0 @@P@P R0SRp0@-M( @000 P 0QQ*l Q $\$̠R q $Ѝ0$ ! Ѝ0{ 0@-M( \@004 P 0QQP ! Ѝ08 aQ $R | lЍ0{ D0@-M( /@004 P 0QQ:L b! Ѝ04 Q $R ~ @Ѝ0{ D@-,-Pp  @zn@-,Pp  @ipp@-DAM0' ( $$1 4 Ph!$0Q  2PP01ua0QsP0 $`P\0Ѝp@|( 004 PAl $0Q $R ~2P `Q Pv 0 P$\Ѝp{ p@-\h$Ѝ1S2'p+04:$0    :ƌ3$0 >ƌ3$0{ 4: { ~  ```~  `p{ v @-D0$ &$ P$@{ @-\@0S $ 6$0P@ K { 0@-M @ P  0)p  0 0S SU00Ѝ00 #$0 R Ѝ08{ $O-M0LPP P0L0U p "Z L 0 SL0 ,S O  [ X 11 L ` `  QU U: @TX%XUU [ @@@/k(oL ` `Z0EgS񟗏 HHHGGGFXFJIpI IJlJK?pDCCDCBHBBAE\EFD4EE=P=(ROULOL`LK`KN8NM`M V>\>0>>pTSSPSTTTASRRTR =<2 2,S,<;l;L;2X2H32:T:T:9p9887x7(655R =<5444HHHG IJK?3 <;L<6\}0 X L L0[e 01Sa MqML00S 00S0Ѝ 0LS 80 L0 #Ra  :RX L LPf 6LL  `P,\|0Sc !pPN T<P[ ,̟ !!0   RLL   PIL pP0 FS  aS U fS iSS PL0x0  RPxP P#RP xPuP( Pp;@h0 0x0 0 S PxP@ x oP[(;h R x0L0 aL  JPL 0 SL0 {S 0D ,P0 0p|J apJL0 P! RL 0}R0 00LP D:pJ * a 01P I00LP 0pI  a 01P @ LP 0wpIt | a 01P @L=PO 00C0SJ 8y a !0Q p   @L#P 00C0S @ 6H B a PHQ00LT pP PT RpR BwR  # NLLȟ0000/ p0 ` 0 a p7GRPP ׶P PPPuL` $00`SU   a \G q0L 0T pP a G q0L 0T vpP a PFQL0 0T epP| PT RpR BwR  # Q a P8FQ00LT @pPbLP< P p L 0Rc0CSF ^,^,^,^,^,^,^,^,^,^,^ ^,^,^,^,^,^,^,^],^,^,^]L0x0 Rx [R x S4E _L`Pş000 H p@ x0` @ R pQD0PPL`\ +P V aDa00LT pP `T RRqBP  # M8  L`$ PP P0ß P_SN `CL`L CP L  0CPTC P0 0  0L 1PL  PB a `a000L  BPL  0PL@ x@=PP 0@Pl@# 0p l0S񟗷]_______]_______]_______l]00LP 0pA 11P @ aAaPLP  ;pPP0  000  PP A tL " @DPPuO a 01Pz LP0Dp@@00LP 09p@5 LP0/pd@, \ a 01P @T LP0p @ p a 01P @C{ Pp{ dx(P0p { Pd@X($T{ a@a00L T pP `T RpR BwR  # PEfUUUU@UU;;;;;;;;;;;;;;;;;;;;;;[[[[[[;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;[[[[[;;U;;;;;;;;;;;;UUU;;;;;;;[[ LP@0Sp\BO a PpBQ00LT pP  / 0S : a PBQ00LT pPL  0S % a PCQ00L T pP  0S  a PlCQ00LT pP  0S  a PCQ00L T pP<  0S  a PDQ00L T pP  0S  a PhDQpL 0T ipP T 0`pP  0S  a PDQLQpP P  a P0EQ00LT :pP\  0S E tL Q @DPP-LL0P ^RE PE# a PEQ00LT pP2D U 0S ` a P,FQ00LT pP @ 0S K a PFQ00LT pP + 0S 6 a PFQ00LT pP4  0S ! a P(GQ00LT pP  0S  a 0|G 00LT pP 0T RpRw BR  L# 0 S L 0!S 04h1 L L 0 SL0 [S a PHQ 0D ,0 T cpPd PT 0RPRu BRLP  # 0 S L 0P]SPLPD aHIa00LT 4pP y 0S  aIa00LT pP e 0S p a PIQ00LT pP-4 P 0S [ a P@JQ00LT pP ; 0S F a PJQ00LT pP & 0S 1 a PJQ00LT pP8  0S  a8Ka00LT pP5  0S  aKa00LT pP!  0S  a PKQ00L 00pP= T pPP  0S  a P\LQ00L 0q0pP T dpP  0S  a PLQ00L 0Q0pP T DpPfH  0S  a P\MQ00L 010pP T $pPF i 0S t a PMQL0 0T  pP. P 0^p\ PP00 a PLNQL0 0T pP00 P ?0Ap> a PNQL0 0T pP xpY   #lL0`00& (p  D 11(@ ` 00|O S`0 ,Sj   0S  a O q0L0 T pP T 0RPRu BR  # L0 X\0 lpP@HX (p0\p S8(p, 4$P0h0@ ;PPIS pLP0#0C0S`ǟPLPQ# nό0$ p,`0@ `@(pp }P L Ɵ  RLP@`T(@ @$,`0@lp Px(plPpPtP-FP &00S & p0(P0 S0 pLƟ P000#0V0p xf @ Rx ,Rh  &d 2XF0 P L0 pP@ (FL Bx  Ɵ 0 @S P7L E  % :m$`$`0 0 0Pp 01P 1PPL`0P0000 00LP0p PP0Sud$g0WVP 4  0x 0pH xğ Rx ,R R0x0 ]RL a  H$  xbp 'SR$x000  ` p  aS !0  `0L0ß a ! @p2h @R x0L0PHCx0L0P4Cx0L0P Cx0L0C}Q Q pUR 01} p?0 0P9p7 PP00\p  (0p  `0 R` 0,R B  0S K U1`r`(`L` PŠ $t0_P? ( R$p x$p$L0P-  0S  `0L0  0S   x0 { Pp l`P,@T  |xDX$p { ,48>P~P QX$t  a 0 pJ}p Q1 `0 P R` 0,RX (0`pP (-q01\ 0Qp 4 ( Q0 0,004  , 0 ``0   0 @S '`0P R` 0,R (0`pM a$~01(p 0p`0p{ | 0S  ~ P $  u P $  .  Z\ $pw$pO (0rp aH01` h_ 0S a`030p/ 02S00/{ @-`@ M0,PU pDW0u03TU WppW l0 0 PS P 0h Ѝ@ ЍT]B0~  -$M b0 F ?L"0Sv$}|}} 0\Q|T"\D@\X2A Q0\ 0$P @P $?"0 "cX H2 Z Z? J?P@ tL"|d| 0@ @Pn>@ 0,Ѝ/?Ҡ'Π Z 0 ᗲ V (Wj!X 0Lp5 p@ P \JT@\2SD nWQ6\˜0\9X  0T"\D p0Q 0\\l TL"\D| 0P  >W\Z L"L"ں0 0{ ~  PVQ  Q@-D`H@@P D2S 0 W@ W{ 8O-a$M)`@Pm DPg @PAP먑 >= 〱@P0 0      ph>@!@2 @ @ _ L2 S0 # APA D2 @ IPT~0@2$Ѝ! 1F 0@  .0DP0L0 AP0 P$ )$ЍOV{ ~  \@-`$M0 1R7 0R@P  sV0@P 0p,S  eV   a_` 7= 0`pzH0@X 0a峯o_$ЍAPꐀ T @- @RM  000WЍ <@N p@-`@0 0P`<84 @P0` 40 0DPPL p~ D0@-0 0@@4d@d$@<4D ~ p@-0S0@08 HRP@" :R Ppb RPddd400SPpb R:RR8@@P 4|b<@ @$P 4$Q4 ,0Sb (21~ 20Sy 00S0 0P@@4 P 4@P8 @  R@ PLP@P8P4P@Q@0< I R @ 8 4 0P0 80S00CS0P40@P  P z00@S!\  P m P f1Ss 0QPo TY<P2Th P M P '0 804 P ?~ { yh<p@-P쑟쁟qA'U;0S= SR0080S9 00p! 0S [ڌ!^D fs[ 0\ ,R$  #60S 0 zTZd4Ѝ sTSd4ЍU0 Fs 00op0]4Ѝ XTV OT 2$ 0eؠ$ 0  e{ ~ Xy l8@-X@00S 000p88Ph ,0 RhP800"p8{ *@-@00S 00p0p@ 0S $ 1$000p00@(0$0$@  { @-,@00H R008~ A-Á0P`PP`Pp ,0S* UW'UW$$ x1RW P $0$0T!SI WU:@!>;C01W0$0AQ$PUq$p 8 0$ ܀R84:0 4 R$0 V  " 0 S W |  l  0 S U@  |p3{ *\)0p@-hA0P0`` S U <  p0 S V  p 0$ $($ Gp3,0UVS0 1S0S $ 0$"$ h0p  Q R&$ Th$`p@%'P B\@Pa0$`h0p{ ]8@-4AP $0$Q>;C10' 1R)\&,Q# P! $!>AP $ 80S R$>L QP10$08 `0p3R$0>;CQ$0( $ 8( F 8 A 8{ 0@-EU000P2 $ >+B 0B,S񟗌dd||||||||||||||||||||||̓̓ll|||||||||||||||tt0S* R'$ğ>kAV``x PS#Q #Q  Q 10#$0C    `XS!0B Ap300#S R   *V,\ Q S   ```"R  r \ Q  SQPRI  \k RŸ Q , Q 2Q* g  10$0hR VAl Vb !V`` 1`#$``Ar  E Q  LtL!!RVB V V $P$!R$ >+B! P4` $0` 墣0h0j10/$0h  BQA1  Q$>L Q40 0$0@  XLk`{ #%APPk.x06@@ ...A-B$0P>+CBQ`  Q  U d  Uh  Q V4  rQSS3#^* QTUVh1Q 1P$P,+BPQ S:0%$0!S>+C1!0X4R0p!$0h VULS0 4q!0< p30 P'1 0S`/ $0 S >;C108$0A X  S  M 0hp $0Q>;C01P$P\ < @ 4 { ,]0tA-B0P0`` Sp2 U p   R VH  H  R !R$">A1j10 SEVUZWXVh 1q`$` W$0吁>;C100RWUV ,0#S<1& VP $ >+B₀!qP$P!R $ >+B! TRh$`h  !p30@ 0S $0>;C0Th$`Ap \ H  8 z { ]0tA-B0P0`` Sp2 U  Z  R Vx O Q  R' !R($@">A1$s$20 SNVUcWaʁ 1V0$01$0U1$0 ! W$0圁>;C100WUV X1#) `1DA 0S? $0>;C0Th$`A}!R $ >+B!!TRh$`h  `p3, R P V U$ >+B₀!Pa$` l X $ >+B₀!q`$`{ \]0tp@-A00ppP&0PU! 1 S ,P P  R U$T/ $PS ,0xS`0h 0p$P>LT0U0$08` U [$P0 , ((( O$0{ P'A-@A0P`0p U(444444pPV4ȢXآТpPpP , 0 S $0" !!40`$0\`U$0\`2Ts$ { ,C-4M`P (0 @@`  0 0㣴`ሻTP, U0DSo4ЍC0FS 3( V V Cs0 ) (  0Q0 4\ 4 $04Ѝ@s0 0SVV4ЍCp0= 3 @p r00 Sc $ " !’ ƌB0Π,ȀQ a  P | 0cR 8\ < 2m4ЍCp0DSr @1$02011\ $0p 㴞p 0$ )%(a0 $ R0 yD 0UPPCPS$P?SR$P{4x$4!81 ,,@$\@傞0pg $0aQ  ) P Qx  P\@347I 274D`p<0SD0 S X 4ЍCTM(p<0 SD0S@@{ @-@MPp`P8p& t 4p 0S $0t 201 10 8 00 v3 R?32 P\$0Ѝ{        @-@MPp`Pp 4p 0  ķ0SЍ$0@ 20 0& P$\0Ѝ@ݳ{ @ @-M` (0(P@, 20 4ㄷpRW# V\$0t" !!40T $0\ U V񟗄(4ȫ =$0"Q?32$0ЍB704 pT0S pop $0!201!0$ \0Qp 0$ xA)  $0@R 0 t0 3$0VC@thL00>p겤$0TL@@$@Ѝ@轿$02$028$028$028$00$08<$0d $0 0$0=$0=$0,,, |L$ xL{ ,P> ?><:8642L0@-@@p0SPʜp @蠺{ =8@-D@PPp8,<P8 T 0S 8{ =@-l@00S 0 0S $ 0$000@( 7  1 { D`?p@-@00$`S! 00ppP  0 R  Q S p$80$0p00kpp@ p$ p p{ h8@-@00PMp8 $0  3 d /o6T@b@F    0D$0 X6@h$` p0%l0l d P  00p{  @  @ < @ \@- A0h R$0 - S1 S @P P  K  E  >;C10$0  @_ R` >;C01<$< >;C01$ R{ 21(<8@-C3h R(0G1S( $0#SF, RP  M RrpS  PQPUu@>;C01$0$08  8 R%0"$Ÿ P UGŸ Q7 ( S )  H$ 0! 8 ! 8@t 8 ! 8Ÿ>;C10$0S0 >A40$087 S QI$ 8 R ! F !Sb0d001$8A  @QFao4Q`( S60v001!$ 8 cH0  c L`  S~H$0 V ItH$ 0A a /oXQ b LSD0|001$$ 8L -$0  { :<X\@-@00pP ,0S0 S!  $ d>+B !2$00 @0$0$ ,>+B! 0$0 { FP@-E5*0Sh UP$`(0Sq>kF0FS5`1$0 0hU RZ  Q$0 R  &  $5$$ h00 V45>+F21005$05P+40S= 4VY 0$ 0 R S 0dT0 S P$>kFa 6 $0@ R0 R 0p i  c 0SV*,\ P 3>F01P$0ʬQ<x3 Q 0 Q0< SX30 S1S1S4 0\G0S0Sʸ+30S52`1$0fPL R R@$0 Sc 4 Sd Y S_ " SZ<2 !#0$0T $2!$ h0   a 0(  00Gp^ S  S' V S !G QPVQ |!V 1>+F$\  !0$0 1h0`` S; :;R<;Ppp PPP QV VPPU W`>  40 O  `Q` ! PW" d`{ x`PP;>4! "O-F MPpUS fP7 $`>F'0ISWUtPJ V, XR #@&V 8&V S0 6 0S5$0a X7 %S8  S2  BS Ѝ$0>;C 01#$0 WU% SQ0;0$000S 00cpV UT8%$Ph ЍZ d#>+C '0BSY$ P, 4R0q0S 0$0S S S $0>+C4!0[$P ЍOC>+C' BR\dS`p`3,0P  &S Z  0S úU Q$ RjUWg3$0|U XT 30S W EVWT | dP\3VZ X L3, 剐1RT 38#$Ph ``P< c K SF<E<$0 ЍOB2% "V X 0 S$0 S! F pE00p&$0>+Cq0 S  Wx 00 S U H ' Z0B\qPPE|qR$p$P$0!>;C1 2$"[h0$PR1YT Vx00$0RA<LR1GR1B;Q0/$0h x Q$PZ 0 ! * 0qF|PR$P:UM WK W U 00 0 S U 0 S W| Q0$0 0 R0r0ppp E{ ('Bs |4]A`@@@ xPb+C-F0P``UO xvP1 $0ll&SSppjp3<&F U0q0 VQ$, >LAXR V  W U00 '  %$0SS   7U U V RV` . 008%S 00p0x07 U U ~ VPSV p W S  VUQڐ$S  +02$0VPD1$0Q1$0L ,pW UppUVӏ$$샟PU p UVSpWqP RP0"1$0 VY '  tp3R0aR`3Ph0$P3`V00S P W $$3XBR\ Up V{ 2W଀2""h Th`$`"RS900"$0h  o 00p|p2@0SBs $08r>;C10 V  ThR$`' \PQ#  L SmPk $ 3>+B BR,+a`$`!Sa<;0$01X}C譕 $ (  XV0\ <  ,,!X(1h01XAR 0t@S'SR$(,0$ h0   { @?\rB]^0_At<`@-` M@P!(0p`9` 04 ЍO-Jp,MP$p` :|P* 0\p:r$`Z -:h00 .S  S.S 0 @STT .S $@f  ,$PB $  RJ0S 1S/ B ,`P $ 000 0@90@0S R R00Q40x9 x) R00;S Q} 0 <R P 4)8Q ( &B,Ѝ 8 R R 0 ,0(S0,0 S mB(0$ $0|8P lhQ~ ,0\(S `0LhS( 00 00^ 0F `P 9 0Q|X0'S \0S : GQo`0Sh(Pl (w0 S0L0(0`} S$ 00Fh\'T7\ X"ap0|(6 J 4`,V`p`V,0S  0  A/2S ,6QQR$0 !$0$ (0d\6P 0 R  46 40 H3/V 0@00 6Q1  A,Ѝ1%S 0wS0,00 nS00,0 $ 0.S  `z0 R  l5 80 H3/7(Cx 2A \+WA$  YXD * f*[P $  REY: *xP2  0h0C 0 I*0 @   T $   Qc0S P Q01S>$`3Pg$Pc !A] A,Ѝ ~ {p  AI,0 0 0 09$00ß P @$  I#>A420@0:bP 20@00`0S}$0:+C Rj:, S030#R(00Y xltt"Aq 0SF S?x p?`@ 0@ '$ 0${pwSS !@@$ @0$ @0tX R \P6 PS Tph!@$eap 0x ?S , o@ @$0 c@ $ d0 @00  R@ X@$ 0 L  ~ {  yT<̋M4PhP@=C8{ B@=@82C\O-G 000LA >S񟗳<<DDDDDD((DDD<DD<DpppDDpppDDDD((DDDDDDDDDDDDDDDDDDppppDD!SR|2x" 6S S 8 0& '>4Wp| p!SRi 2pp00⻅aA4 @80P@ D0A Ѝ!SR1 01 W1p 1p!SRN @TPA\1p!SR?pDp 81!SR(1pp 1!SR 0p N?0' L 0R42 p 0d0 0(prpv h0 p &>}!r_^sP_N]HG->LL`>\ 񟗙h(t@Xh@X Pp@_00XXA  H%j(0SI 0@Pp00X403/( @ 4R 0( R(0S  0( R(0S (0S ,,, j>R PCO$/D0O-S$M` $Ѝ0 0PPcPiL?UX?P < ("2q 'v1pp q 0@ !-\ @`U: hPd T! 0!$Ѝ\1? P1T!0pq 0 @$$$!=LTСP q  0QP  00P00TT0 h!`!  0`  PhP T0pp  0 @  Pd@{ Xy XHPO4 ?Q@-0M @@@? #@Ѝ$ @ F=@L0/H D0 0CLSttdt/R{ (000 R/t R  t /~  Q@- P 0z- M0#ᔻ Ѝp@-0M_S@ 0GS x+Pl`PU ЍpЍpsP 8 V<(00  0MlP ~ C-B MpP0` ,R50 0 0.S! r@PJ fX`0LE0x 0 *x|1  1S !x000 Ѝ0S<<@$APZcA:Z(0CZ[  0CZ Z <>Z @:0Z 0Zm0 SR00S0 @0 #$.0 00b  0 &ZZ (=ZA 0CZ :0Z Z7HP V| 00 0 dpd.; 0P   D=Z 0CZ 'Z ڱ@P ձ8$8(PB 0@PUT QP   V   0 V 0@P$(p (E8  0p5p 0 0R Z FZJ ;Z 0ZX<10  P iP LL00 4s!000 0$00 SR@00S0 P0 `&!0/G1DP 0\ 0  <Ѝ0CZ~0 00<Ѝ:Z= Z:Z(0CZ5*Z4 0CZ0 0  0ZP:ZcZ@:Z 0P40 hPl @T @`DP{i 0:9Zw (:0Z% Z10 l /0@"P"@TP TJ:@`DP 0 i: 0CZ ZL0 0  0hZk :FJJZ @PD@00 B:w%Z*Z**Z0 e0#1iƯ&ƯJ( @_0UT 㦰V%%00(0 0  0&H8Zu0 %P "! =O&OD btQ R DP@0P@ 9 mV&0 0 00P 00 gP ]@T? N 7 '0S0 0 cq"R0 S0Q0s @PD@$ =0 9"Z">J0CS[0   0"S&88G(`p">J0CS PPJ@2$>"lFP`p 0  0 61  P gP 000 0t  &* RA60SR@P4R1(XP ThZ 0%0 0 %0QP  @PD@ >90 0m ಯ @ P㪯B?JP& 00"*&"0% G @$ ,PPCɠ.9ƌ7P%YF0:@#P0 0pb`!@ 0آPp 0@P p 0p bxCPW V@>;P00b 0q?@P @ P 0WV 0 0  @PD@F0 8@4? ß 0 0`p&!/G1 0  V=W V@PX `@P@P>-0 0  0p0 P000 0/0 0*&!/G1@P 0 0R3&=#@P> 0 0.2="@P 0 0/0 0  @D0 <8| 0 02&>"@P0D@ *8Z Z0 0TkAeSr )1R[Jd?PxgVD{ y @qdT0XpPWt0Z :Z 0Z 0QP1&?!`p/ᙯJ0J@"P"@TPZ e  0 0Z z/0@"P"@TP Tx:@PD@ $ 7ZGZ :ZC*o1Z*0 0#1_&_E ?SRX V00%%AP2,> " ?@PI @PD@ Y7l @PD@ N7TVs* ǭ0"0QP 0 0s  @PD@ -70g<31  P 0eP f[ P d304sr0m r0 0 00PC ePz 0 C04s.3R 0 SR00S @4@0P 0 SR@00S0 P0  04Ra ap0`p0 SRP00S0 0 (4%0 00b 0 @00 @0#1Ư&ƯJ @_Ap*A O+QUTR V%%00 WVj* FPP @2$>" ` p 0 ܬ B@7TP@ U T= D0 @ 0 0 E6V  T 0 SZ/0 0  @D0 (6&!UD/G1 *  ? 0 +M<Z0 `0\ CP e\ dP P G04s0 -q0m 0 Vh$!p/E1E@P 0 01 0WV ~ 0 00 0 LP0@@> pQ`1^&?A! 00P 00 cP 0 .@P )8J$8L(\@PAyA&0 0PV VP| @PD@ 0 5V:@PD@  y50 0 Pf@@$P%!0 0AP@P'!0 0A0 SR00S;0 z0v | «WV@P  0Km`p 0 0S 㥫 0 0+0V% 0@P 0> 0 SUڼ0 ㇫ 0  0+0CZA0 + @'< @2@Ћ$(p (E8  0p 0 p `)0CZ/0@"P"@TPT Q up,0 0|<Z% @`DPR<Z q@0 ct"R0 S 280#ApP 0l.@  @04@ 04@0#1IX-P0UTl @PD@ 40V3:@PD@  v4)@0 D 0 0 0h4 W V' 3&=#@PD@ E$ Ό44V`p@P,< $  0e`p 0 0jU  0 0ZA&,+0 0 %cZ  @ c@T  @@Z0 @PD@ 4@PD@tx @PD@ 30-/*4g @PD@s 37/4@PD@D d 3@PD@U -4 @PD@O 3 ,3& @D?0 3r/0 0@Z &! /G1 0V  0@&G`p VPX@PD@  n0 ;1  P*0 0 ; 0004s;00n`vp,! Q P V@ L˟H 0PP ?#@PT @PD@ <3c 0h @D .3 Sᨩj0|֜ `p"fϜ@̜P:0 SH@d,$8q !FP  0 ?!9ZU| \  .40S3.  0@PD@<0 0 s|c0 @PD@F` a 02V< 0 V 0vS*0@P 0 A"  ' B@  L  ` U a[ P| H04s n0 n0y Za @DP@0@ /2ܨ*0 0h D7 00WST @Dp0 B2 0o0` QP000S`p @D 0 %2 @D@0 2 @PD@ 0 2h @D 0 2@ @PD@ 1wVP+0ᅂ0200 ,0 `\ EP 04s0 0 `Z] PZ \504s^m0 Ym0L ?"0 0 0 00 0 0 0ZT+*0 0@PD@ @PD@ 1`vpt @D 1I`vpHWV 0 0E`vp _P  @ _P  @ h_P P p304sl0 l0 31 0 00`vp4 @D0 0 00 0+1 @D0 1 @D0 1 @D0 1X @D@ 0PA &0@$P%`vpA[4pP0 00(:bn`:vl0 &l0 _ @DPZ 0 000$0 0 00 l0G Kd4TpP 065000 k0 @PD@ k0 |0ZA$0@P 0!pPWt>X<{ ] dT(l`TPB\- M ࠃPv Ѝ00@-/C B R@ "Q( P 0! $r7CA/CRQ- S/C BR'S/C BR+S P rk0"@ w P 004sk0 k0 00k0 Ok0 Ik0 n@-0 @0@_`p P ^W @P00?C0CeSx x      x A0CSIp WWp 2Q Q>@PD@x0prp0 pp0Lr0 pp0(rpp0CQ] .QX U1Qa" @PD@@0 -0CQ 1Q Q QFQ 0CQ*Q4 l1Qha FQ5 H0CQPa H @`DPp s\ 0- @`D@ 0r-``````````*#fsP -Y\ p b"56q0!&%b .n @-@ P< rh06 P 004sh0 "h0"00F.C BR /C BSR/C BR/C BRd S /C BR ?CCP>h0 0S 0 0P/Xy l\C-00l@T @T 080S R}, @T0BTttpt`ttP@T T00 Rt R t @Tp |{ ~ `` 0A-@Tp$e@P "h0 gP4`P04sh0 h0 6je@PP0P A04s``4`ŕg0 ꐁ p tAC-MUP\ PX PT PP PL PH PD P@ Ee <@TD` @TD`` @TDo @TDBo @TxDxd @T\Dl @TR 8ß  R4Q # XC AGV QRC  ߒ  XyY  j Β YhVB 7WXP4T$N@DC趒K MBz㩒@V TM4PD3 㔒 㐒,㋒ *㆒!/) } xVT  ` `P0S,iRlc $^ ZVy Qp Mk Hf@TZ {  p yP`X8@-P?d@ B  @-0 1@~  }  @-0 3@~  } A-AM0#S```/[PPT _PQ p0|0 S  0 ,SL``0D S``0#S  0`0S& [0`.W^0S  %S_@p^P0 @ lЍ0S 00@ pM000`X ]%p< V%65Ѝ萀 VqUaXVVC-@XxX0A-`PV@  P 0 Q p 0 Q0!000q0 pA< ꀀD@I-@`p P/0@ PsR0) 00M   P0 P0@_@P 0(`V@ 0`0 3/0T0 3/K tR rR0S  #4dV, U0p@-@Tp7\@P! 3QP^0S# ^@>0P@S ;]Ph]PTT M\@Pp0@S`  kPP ꐁ @-\@Pbp2Y0p0 R00U`  z"萀 XC-\A0 ,RPDa @p R0@06@pC^0S! >^P 0C+ K"C2 D`'^@Q 0"C{2^`x0^@PD &` ^@Q "C^2ꐀ X YX@-P`p~]0 @| T "05 50,S @+\000 S000 S@w+ꐀ V8Up@-PP`Q0@W,T p@h+0  R    Rp@\+ꐀ G-;Tp] 0,S``0` S  0`@S " C R%S 0`00C0 S?00@0 D  R00laP 2Y0S  08@0"Q000  G+ HP CP" 1y" <P 7P 6Y0S(A@\P}P 0&OV(0S TP DP9 0Y R  P/ P 5Y0S P"OPtPP? V`P 0NTV&[VZ(x v! yXP Z00S0S (P"1001 0S S S [ P! SZOP}  `FPA!(DP|000q 0SS p -!0 0(.ꐀ Y * PaX 0000WP  I 0SR c! Q BW T 0`& 90Q Q\# 0 000X~Q Q    #%80 0 0i)0 0dPm 0S0L000f0iQUIf 0Z P 00CS@ 2 @Pa X p X 0000P) 0`pW@W0Kb `[!V p\  BRA|!R8 T  CT"L!0 0WY  00 f`  0[00KWI 880E`0 i BR0i+S90 )0X X (8( $ ~ ^t_@_7G-A`QMpD`Fp  4VZxststttttttttstxssttttttttttttttttxststttttttttstxssttttt 0 P`p  0pP @1lP@@Ѝ 0P`0P` 0P` PЍP~ ijO-pM@*P8 DG4Q8uduudududududududududuHvduuu4vdududuHvdududududududududududuuduudududududududududuHvduuu4vdududuHvfW dW!  _Ѝ `P̀ $P[ `p pPE0u@Ѝ `P 0`p vpPE0u@ `Pxp `P괳 8@-PP8P@ P8@C-P, PU  0`0VjP @pHpPU ~[PP`h PP `00 O-@P M b`R ` p 0M( 000@ 0 @0 0@Z 0JY  \a 0 0P` 0  10S,  (0`0 S@" @@ ; V\S` X 'S 0W "Sp'S "Sp(00(, 0 ,0P( 0 1 00@ 0 @00@R K`p 0 0P\ 0 K 0 ,0 #,0 KA-PQ `Vp# @T "T p @T 00@\'TTp p `VO-`MP}P@T{0q @RXy Pl  pe p`  pZ ' 0 .[0 00PJ 0S t00@E X00@> 0S P< \ 0 00Q0  d!r { 0 B0 0h f@ DЍ < 4 V 0$0 N `L`0P P/ R//-LM L0 !!#LЍ@BD0p@-`VpP@UPRQPJ@D053/t`Vpx0p@- pPR@h  0`S 0 apP @0@ p} Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/P'Q @-@A/SRQPM`-Ѝ /SRQPM`-Ѝ /@-A-@`p4#@P0@VP@A-`p@.A#HP0@VP@QO-MPp@pPp@S r0@X `\2?oS c5"c&X d(p )8 Q!*G* QG20k N )p qQ!*`G*VG2 Ȍ\7`?oS0fP8 c c7!5&s &+   G'8  Q P!*PJ* QPJ200l0 0x'x . Q !* J* Q J200kX&00*)8Q !* K*Q K20g   )p   Q!*`G* VG2ȌZXVoYW UP3P## P!N*L 0i set the hash table size close to --help show this message and exit --target-help show target specific options -I DIR add DIR to search list for .include directives -J don't warn about signed overflow -K warn when differences altered for long displacements -L,--keep-locals keep local symbols (e.g. starting with `L') -M,--mri assemble in MRI compatibility mode --MD FILE write dependency information in FILE (default none) -nocpp ignored -o OBJFILE name the object-file output OBJFILE (default a.out) -R fold data section into text section --reduce-memory-overheads prefer smaller memory use at the cost of longer assembly times --statistics print various measured statistics from execution --strip-local-absolute strip local absolute symbols --traditional-format Use same format as native assembler when possible --version print assembler version number and exit -W --no-warn suppress warnings --warn don't suppress warnings --fatal-warnings treat warnings as errors -w ignored -X ignored -Z generate object file even after errors --listing-lhs-width set the width in words of the output data column of the listing --listing-lhs-width2 set the width in words of the continuation lines of the output data column; ignored if smaller than the width of the first line --listing-rhs-width set the max width in characters of the lines from the source file --listing-cont-lines set the maximum number of continuation lines used for the output data column of the listing @FILE read options from FILE Report bugs to %s GNU assembler %s Copyright 2012 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License version 3 or later. This program has absolutely no warranty. This assembler was configured for a target of `%s'. emulations not handled in this configurationalias = %s canonical = %s cpu-type = %s bfd-target = %s bad defsym; format is --defsym name=valueerrorwarningInvalid --size-check= option: `%s'alternateinvalid listing option `%c'--hash-size needs a numeric argument/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/as.c.gasversion..text.data.bss*ABS**UND**GAS `reg' section**GAS `expr' section*.note.GNU-stack%d warnings, treating warnings as errorscompress-debug-sectionsnocompress-debug-sectionsdebug-prefix-mapdefsymdump-configemulationexecstacknoexecstacksize-checkfatal-warningsgdwarf-2gdwarf2gen-debuggstabsgstabs+hash-sizehelpkeep-localslisting-lhs-widthlisting-lhs-width2listing-rhs-widthlisting-cont-linesMDmrinocppno-warnreduce-memory-overheadsstatisticsstrip-local-absoluteversionverbosetarget-helptraditional-formatwarnatof_generic/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/atof-generic.cnaninfinity+-failed sanity check1.2.8s_ifs_elseifinvalid identifier for ".ifdef"non-constant expression in ".if" statement/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/cond.cbad format for ifc or ifnc".elseif" without matching ".if"".elseif" after ".else"here is the previous ".else"here is the previous ".if"non-constant expression in ".elseif" statement".endif" without ".if"".else" without matching ".if"duplicate ".else".ifeqs syntax errorifdefifndefelseendifendcend of macro inside conditionalend of file inside conditionalhere is the start of the unterminated conditionalhere is the "else" of the unterminated conditional \ can't open `%s' for writingcan't close `%s'get_line_subsegemit_inc_line_addrget_frag_fixdwarf2dbg_convert_fragemit_fixed_inc_line_addrdwarf2_finishout_debug_info/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/dwarf2dbg.cunaligned opcodes detected in executable segment.Loc.%u.%ufile number less than onefile number %ld already allocatedunassigned file number %ldbasic_blockprologue_endepilogue_beginis_stmtis_stmt value not 0 or 1isa number less than zerodiscriminatordiscriminator less than zerounknown .loc sub-directive `%s'expected 0 or 1.debug_line.debug_infoduplicate .debug_line sectionsdwarf line number information for %s ignored.debug_abbrev.debug_aranges.debug_rangesGNU AS %soutput_cfi_insnencoding_sizeselect_cie_for_fdedot_cfiدd(,/x4 x4 x4,x4Dx4Px4`x4 px4x4x4x4x4 İx4 ذx4-d1x4T̬/bad register expressionCFI instruction used without previous .cfi_startprocinvalid or unsupported encoding in .cfi_lsda.cfi_lsda requires encoding and symbol argumentswrong second argument to .cfi_lsdainvalid or unsupported encoding in .cfi_personality.cfi_personality requires encoding and symbol argumentswrong second argument to .cfi_personality.eh_frame.debug_frame/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/dw2gencfi.cmissing separatorprevious CFI entry not closed (missing .cfi_endproc)simple.cfi_endproc without corresponding .cfi_startprocwrong third argument to .cfi_val_encoded_addrregister save offset not a multiple of %uCFI state restore without previous rememberopen CFI at the end of file; missing .cfi_endproc directivecfi_sectionscfi_endproccfi_def_cfacfi_def_cfa_registercfi_def_cfa_offsetcfi_adjust_cfa_offsetcfi_offsetcfi_rel_offsetcfi_registercfi_return_columncfi_restorecfi_undefinedcfi_same_valuecfi_remember_statecfi_restore_statecfi_window_savecfi_escapecfi_signal_framecfi_val_encoded_addreh_frame_estimate_size_before_relaxeh_frame_convert_frag/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/ehopt.cinteger_constantexpr_set_rank   bad floating-point constant: exponent overflowbad floating-point constant: unknown error code=%da bignum with underscores may not have more than 8 hex digits in any word/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/expr.ca bignum with underscores must have exactly 4 wordsbackward ref to unknown label "%d:"bignum invalidfloating point number invalidL0expr.c(operand): bad atof_generic return val %dUnary operator %c ignored because bad operand followsstartof.sizeof.syntax error in .startof. or .sizeof..startof.%s.sizeof.%sbad expressionmissing '%c'missing operand; zero assumedmissing right bracketleft operand is a bignum; integer 0 assumedleft operand is a float; integer 0 assumedright operand is a bignum; integer 0 assumedright operand is a float; integer 0 assumeddivision by zeroshift countoperation combines symbols in different segments   ++++\^^+044+++ľľ+,ff+M+<vv+ļ+L5+   +  +޿޿++`+8XX+..++Ⱦ+h+**x+x+::9+¼¼+dI@BuhؖҋcU4ph{3'"2I%% dKE)0bkMǢ. 8/t#ڰͼ3&Nk'0S6q.hY>VPr^2>#njd8n헧?O{t9SSz ſt[Am-xg63 ւR`i;.eNQG3o#VmBf)?`MMCua o"4W]K<_ZX`]OSOJp?sa*'6;Nё\C9#J{/L F%u^)Ǻd(\(\(\(\(\(\(\(\  frag_newattempt to allocate data in absolute sectionattempt to allocate data in common section/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/frags.ccan't extend frag %u charshash_deleteexists/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/hash.cinput_file_opencan't read from %s: %s/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/input-file.c{standard input}can't open %s for reading: %sO_APPPPcan't close %s: %snew_logical_line_flagsmacros nested too deeplypartial line at end of file ignored/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/input-scrub.clisting_listinglisting_list%02Xdefvalscllineendeflnsizedimtagstabsstabn%s %s page %d ARM GAS % 4d %s % 4d ???? % 4d %04x %c%c**** %s % 4d Warning:Error:.debug.linecan't open %s: %s GNU assembler version %s (%s) using BFD version %s. options passed : input file : %s output file : %s target : %s%Y-%m-%dT%H:%M:%S.000%z time stamp : %s %s %s /srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/listing.c%4u:%-13s **** %s NO DEFINED SYMBOLS %016llxDEFINED SYMBOLS %20s:%-5d %s:%s %s %33s:%s %s NO UNDEFINED SYMBOLS UNDEFINED SYMBOLS strange paper height, set to no formnew line in titlemissing `)'LOCAL.LL%04x`%s' was already used as parameter (or another local) name-1% operator needs absolute expression%lld$NARGNARGMissing parameter qualifier for `%s' in macro `%s'vararg`%s' is not a valid parameter qualifier for `%s' in macro `%s'Pointless default value for required parameter `%s' in macro `%s'A parameter named `%s' already exists for macro `%s'Reserved word `%s' used as parameter in macro `%s'ENDRIRPCIRPIREPCIREPREPTREPMACROENDMunexpected end of file in macro `%s' definitionmissing `)' after formals in macro definition `%s'Missing macro nameBad parameter list for macro `%s'Macro `%s' was already definedconfusion in formal parametersParameter named `%s' does not exist for macro `%s'Value for parameter `%s' of macro `%s' was already specifiedcan't mix positional and keyword argumentstoo many positional argumentsMissing value for required parameter `%s' of macro `%s'Attempt to purge non-existant macro `%s'unexpected end of file in irp or irpcmissing model parameteras_internal_value_out_of_range%s: Assembler messages: %s:%u: Warning: Error: Fatal error: Internal error! Assertion failure in %s at %s line %d. Assertion failure at %s line %d. Please report this bug. Internal error, aborting at %s line %d in %s Internal error, aborting at %s line %d /srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/messages.c%s out of domain (%d is not a multiple of %d)%s out of range (%d is not between %d and %d)%s out of range (0x%s is not between 0x%s and 0x%s)can't open a bfd on stdout %sselected target format '%s' unknowncan't create %s: %sfinish_bundlepending_bundle_sizestart_bundlestringer_append_char $ 0(xH0xH 8x @x Hx P Ldt80|h=^p=p= 808080`d80`f80`xd)d)\dd)\fd)\x<d)d)d)d) d) (d)0d)8d) 0@`dH\ԦPX`dܦlt|CCC ,Tx0L,M L `f0AAT80\Ħ( (0̦8@(HTV\0hd80hlt|@0,M ,80HBx0\00080$   $ 0\8,@TH,PX80`hlt@0xC80`fd)d)10sdtsnlssWxH xH xHxH!xHAh00\<@1Hh=PAX0`ss4ThDp80,d)do_repeat_with_expanders_aligns_bundle_unlockemit_leb128_exprs_weakrefs_vendor_attributebad or irreducible absolute expression.abort detected. Abandoning ship.unknown floating type type '%c'floating point constant too largeignoring fill value in absolute section/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/read.cinvalid segment "%s"only constant offsets supported in absolute sectionmissing closing `%c'stray `\'attempt to redefine pseudo-op `%s' ignoredstart address not supportedexpected address expressionsymbol "%s" undefined; zero assumedsome symbol undefined; zero assumedignoring macro exit outside a macro definition.error constructing %s pseudo-op table: %smdobjstandardcfiexpected alignment after sizealignment negative; 0 assumedalignment not a power of 2MRI mode not supported for this target%s without %sjunk at end of line, first unrecognized character is `%c'junk at end of line, first unrecognized character valued 0x%xmissing or bad offset expressionmissing reloc typeunrecognized reloc typebad reloc expression.rept, .irp, or .irpc.macro.end%c encountered without preceding %salignment too large: %u assumedexpected fill pattern missing.err encountered.fail %ld encountered.fill size clamped to %dsize negative; .fill ignoredrepeat < 0; .fill ignoreddiscardone_onlysame_sizesame_contentsunrecognized .linkonce type `%s'.linkonce is not supported for this object file formatbfd_set_section_flags: %smissing valuebad floating literal: %s.bundle_align_mode alignment too large (maximum %u)cannot change .bundle_align_mode inside .bundle_lock.bundle_lock is meaningless without .bundle_align_mode.bundle_unlock without preceding .bundle_lock.bundle_lock sequence is %u bytes, but bundle size only %umissing .func.endfunc missing for previous .func%c%sillegal expressionmissing expressionattempt to set value of section symbolcan't equate global symbol `%s' with register name`%s' can't be equated to common symbol '%s'symbol `%s' is already definedattempt to store value in absolute sectionzero assumed for missing expressionregister value used as expressionvalue 0x%llx truncated to 0x%llxbignum truncated to %d bytesunsupported variable size or fill value.space repeat count is zero, ignored.space repeat count is negative, ignoredspace allocation too complex in absolute sectionspace allocation too complex in common sectionunexpected `"' in expressionrva without symbolunterminated string; newline insertedsymbol name not recognised in the current localeexpected symbol namemissing size expressionsize (%ld) out of range, ignoredsize of "%s" is already %ld; not changing to %ld%s%sexpected comma after "%s" => %s: would close weakref loop: %sstrings must be placed into a sectionexpected missing stringline numbers must be positive; line number %d rejectedincompatible flag %i in line directiveunsupported flag %i in line directivethis string may not contain '\0'Attribute name not recognised: %sexpected numeric constantbad string constantexpected , expected comma.error.warning.error directive invoked in source file.warning directive invoked in source file%s argument must be a string.incbin count zero, ignoring `%s'%s/%sseek to end of .incbin file failed `%s'skip (%ld) or count (%ld) invalid for file size (%ld)could not skip to %ld in file `%s'truncated file `%s', %ld of %ld bytes readfile not found: %sunknown pseudo-op: `%s'cannot change section or subsection inside .bundle_lock.bundle_lock sequence at %u bytes but .bundle_align_mode limit is %u bytessingle instruction is %u bytes long but .bundle_align_mode limit is %u#NO_APP .bundle_lock with no matching .bundle_unlockpseudo-op tableabortalignaltmacroasciiascizbalignbalignwbalignlbundle_align_modebundle_unlockbytecommcommon.sdatadcdc.adc.bdc.ddc.ldc.sdc.wdc.xdcbdcb.bdcb.ddcb.ldcb.sdcb.wdcb.xds.bds.dds.lds.pds.sds.wds.xdoubleejectelsecelseifendendfuncendmendrequequiveqverrexitmexternappfileapplinefailfillfloatfuncgloblgnu_attributehwordifbifcifeqifeqsifgeifgtifleifltifnbifncifneifnesifnotdefincbinincludeintirpirepirpcirepclcommlflagslinefilelinkoncellenlonglsymmacromexit.mrinoaltmacronoformatnolistnopageoctaorgp2alignp2alignwp2alignlpageplenprintpsizepurgemquadrelocrepreptrvasbttlsetshortsinglespaceskipsleb128spcstabdstring8string16string32string64structtextthis_GCC_requires_the_GNU_assemblerthis_gcc_requires_the_gnu_assemblerttluleb128xcomxdefxrefxstabsweakrefwordinvalid argument '%s' to -fdebug-prefix-mapstring buffer overflow.stab%c: missing comma.stab%c: description field '%x' too big, try a different debug format%sF%d",%d,0,0,%s .stab.stabstrcomma missing in .xstabsstr/%sL%d%d,0,%d,%s-%s %d,0,%d,%s "void:t1=1",128,0,0,0"%s:F1",%d,0,%d,%s%sendfunc%d"",%d,0,0,%s-%ssubseg_set_restsection_symbol/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/subsegs.cfrag chains: %p %-10s %10d frags report_op_errorsymbol_appendsymbol_clear_list_pointerssymbol_removesymbol_insertS_IS_EXTERNALS_IS_LOCALS_SET_SEGMENTsymbol_newlocal_symbol_convertresolve_symbol_valuesymbol_clonesymbol_previoussymbol_nextverify_symbol_chain-~!%<<>>||~&+||==!=<=>=&&/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/symbols.cinvalid operands (%s and %s sections) for `%s'invalid operand (%s section) for `%s'invalid operands (%s and %s sections) for `%s' when setting `%s'invalid operand (%s section) for `%s' when setting `%s'inserting "%s" into symbol table failed: %sdollarfb"%d" (instance number %d of a %s label)bfd_make_empty_symbol: %ssymbol definition loop encountered at `%s'division by zero when setting `%s'can't resolve value for symbol `%s'attempt to get value of unresolved symbol `%s'section symbols are already globalcan't make register symbol `%s' globalsymbol `%s' is already defined as "%s"/%s%ldAccessing function `%s' as thread-local objectAccessing `%s' as thread-local objectexpr illegalabsentconstant %lxsymbol %*s< %*s%lxregister #%dbiguminus -<bit_notmultiplydividemoduluslshiftrshiftbit_iorbit_xorbit_andneltlogical_andlogical_oradd %*s<> %*s<subtract %*s<{unknown opcode %d}(unnamed)sym frag resolved local written resolving used-in-reloc used extern weak defined weakrefr weakrefd debug%s %*s<symbol tablemini local symbol table%lu mini local symbols created, %lu converted fix_new_internalwrite_contentscompress_debugadjust_reloc_symscvt_frag_to_fillsize_segchain_frchains_together_1set_symtabnumber_to_chars_bigendiannumber_to_chars_littleendianfield fx_size too small to hold %d/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/write.ccan't write %s: %scannot write to output file '%s': %scan't extend frag.debug_ZLIBredefined symbol cannot be used on relocrelocation overflowrelocation out of range%s:%u: bad return from bfd_install_relocation: %xcan't resolve `%s' {%s section} - `%s' {%s section}value of %s too large for field of %d bytes at %s.gnu.linkonceattempt to .org/.space backwards? (%ld)reloc not within (fixed part of) sectioninternal error: fixup not contained within frag%d error%s, %d warning%s, generating bad object file%d error%s, %d warning%s, no object file generatedinvalid offset expressioninvalid reloc expression%s: global symbols not supported in common sectionslocal label `%s' is not definedLocal symbol `%s' can't be equated to common symbol `%s'can't make global register symbol `%s'alignment padding (%lu bytes) not a multiple of %ldattempt to move .org backwards.space specifies non-absolute value.space or .fill with negative value, ignoredInfinite loop encountered whilst attempting to compute the addresses of symbols in section %sfixups: %d fix %s:%d pcrel pcrel_adjust=%d im_disp tcbit done size=%d frag= where=%ld offset=%lx addnumber=%lx %s (%d) +< -<@@A@A @@ЀCCB(`pF݀@@@@hxV^HH @C@CCC@B@BCC@AAAA`p@B 0@P@P @P 0O P00__] 0O_o@P-`p`p@ MO_encode_arm_vfp_reg             @  @  @ @ @ @ @ @ @ @ @ 000 0        @@ @ @ @   @ @   @ @ @ @         0 @  @ @ @  make_mapping_symbolvalidate_immediate_twopartencode_arm_cp_addressdo_fpa_ldmstmencode_thumb32_addr_mode@@````` ,8HP`lx?``<`D`L`T`\`d?`l/`t`|o` ???  5(5#4<D-LT\-dlx4  @@@0 0 @ ( ,4encode_arm_addr_mode_common@?`````````````````````` `(`0`8`@` `H`P`\ `h?`p?`x ?` ?` ?` ?` ?```````?`?`  ,8 ,D P \dp |    `l  $,4< HT x ` l?t| ?t   ? ?      ,8 -DP -\h -Gt -G   5# 5# 5#4  do_vfp_nsyn_opcode`hpx (08@HPXarm_parse_extensionneon_type_promote @ try_vfp_nsyn  do_neon_ld_dupdo_vfp_nsyn_cmpneon_invert_sizedo_neon_movdo_neon_logicmy_get_expressionparse_shift@dX(S0PpPparse_vfp_reg_lists_arm_unwind_save_vfp_armv6parse_address_mainPtMhinsert_reg_aliasdo_neon_revparse_operandsparse_shifter_operand_group_relocsymbol_locatecreate_unwind_entryPPPHPxDxQD,Qdo_t_shiftdo_t_branchdo_vrint_1do_t_ldstdo_t_mov_cmpopcode_lookupmd_assembleoutput_instarm_frag_max_varmd_convert_fragarm_relax_fragarm_handle_alignFF s_thumb_setmd_apply_fix`,\? شD\? شD\?شD\?شD\??ش\?@ش\@ش\@ ش\? شD\? شD\? 8شd\? 9شd\?/شD\?0شD\?شd\?شd?Eش?Eش ??ش?ش ?(?ش,?ش4?<?'ش @?(ش H?+ش L?,ش TBAش-TXBEش-TdB@;ش-T`BD<ش-Th:ش}l:ش}t:ش}|ش}ش}ش}FشxDFشxDG شܸTGش̋E(شL9E(H[HشX0\?#ش\\?$ش\\?%ش\\?&ش\\? ش\\? ش\ \?6ش\\?7ش\&-شh'.شhВ2ش}HЋ1ش}H\?ش0\?ش0F ???ACP `XAG `XAB@ `X AF `X(}0}8}@}H\?L\?T}\}d}l}t}|}}}\ )شx,\ *شx, O|8 O=VDTTDPTTDTTD@TT<V(g(g<OV(g(g Df DfLp KRp   N      $ 0 < H T ` l x        N        $ 0 < H T ` l x      N          $ 0 < H T ` l x    N            $ 0 < H T ` l x C شh-TC =شh-TCشh-TC شh-TCشh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-T C شh-TC شh-TC شh-T$C شh-T,C شh-T4C شh-T<C شh-TDC شh-TLC شh-TTC شh-T\C شh-TdC شh-TlC شh-TtC شh-T|C شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TC شh-TGȴشM4QGдL<ZдLд 7DдTTDPдTTDдTTD@дTT=Vд<Vд(g(g<Vд(g(g |8(  |80 |880|8@0|8H 0|8P 7X  7`  7h 7pt6x  t6 t60t6 0t60t6Df5Df5Df5Df5AE( ]^C P踴pdc]^C@踴pdc=@츴44=P츴44xNIW`IWpk3 3k4 3o5 3 gkD(2goG(2gjC(2$gnF(2,JP 4AP蠴1<A@蠴0$D=@44L=P44T4fj؄0\2fn0d頴l頴px蠴頴蠴_3P頴_3P頴_3P頴_3P_3P_3P_3P_3P蠴_3P蠴> dh꠴|.eh ꠴,x/bt6bt6bt6bt6$bt6,bt68bt6@bt6Hat6Pat6Xat6`at6lc t6tc t6|c t6c t6c t6c t6c t6c t6at6at6at6at6e@t6e@t6e@t6e@t6g`t6g`t6 g`t6g`t6 g`t6(g`t64g`t6<g`t6DfPt6LfPt6TfPt6\fPt6hfPt6pfPt6|fPt6fPt6e@t6e@t6e@t6e@t6gk-gh -gj@-gh/(2go-gl0-gnP-gl?(2ht6p |8p |8t 7 t 7p@|8p@|8$t 7,t 74uP|8<uP|8D u`|8Lu`|8TuPt6\uPt6dp t6lp t6tp@t6|p@t60j 0- ` 7xpt6xp|8/n ,2I"2J22KB2L]^蘴t]^p蘴+O蘴hh_蘴hhA@蘴0lAP蘴0lW/FPP8F@@X8@@24|o+ P24|` (*24z@P)24~P)  O|8$H0@@(,H4@(4o '<A 0X `XDA0X `XLA X `XTA  X `X\EdEM  `hM  `lM@  `pM  `xM`  `M  `M  `M  `Mp  `M  `M0  `M  `MP  `M  `M  `0O ,'0_ ,'FlFl\?`&\?p&NTNT\qHhP$\sHhP$hWPxxȼhW@xxȼhW`xxȼAE``d /2``<$AA0XX( ,R2M4ZD8hh@]tHhhPhhX4 P`]+h4 Pp4 Pxhh|hhhhDhDhDh:XXdd;XXdd<XXdd=XXddc>XXc?XXc@XXc@XXc@XXc@XXcAXXcAXXcAXX c!BXX(c!BXX0c!BXXجج8c!BXXЬЬ@ 1CȨȨH 1CP 1CX 1C` ADȩȩh ADp ADx AD AD AD AD QE aF aF 0@P DdTdT DdTdT DPdTdT DPdTdT DdTdT DdTdT D@dTdT D@dTdT  S   S    S@  $ S`  , S  4 Sࠁ  < S  D S  L S  T S   \ S@  d S`  l S  t S   | S@   S`   Sခ   S᠁   S   S   S   S    S@   S`   S    S    S@    S`    S     S⠁    S     S     S(    S (    S@(  $  S`(  ,  S0  4  S 0  <  S@0  D  S`0  L  S、0  T  S㠁0  \  S0  d  S0  l  S8  t  S 8  |  S@8    S`8    S@    S @    S@@    S`@    S䀁@    S䠁@    S@    S@    SH    S H    S@H    S`H    SP    S P    S@P  ! S`P   ! S倁P  ! S堁P  ! SP  $! SP  ,! SX  4! S X  >  l>l>  @>@>X*O x#x#* ""   >>( @ >> @ >>l  >> @ >>t  >>` hh  D  S S D  S S0 88* 88 000+ 000+ + + 0 + 0 88(+ 88@ 000+ 008+ @+ H+ P+   >> @ >>  >>  0== @ 0==   ==  ==  ==X+  ==`+ @ == @ ==h+ @ ==p+ @@ >>x+ P@ ==+ @ >>+ P == D RR D RR8 + + 0+ 0+ + H +  @ `=`=8 p 8=8=0 p ==+  <<+  <<+  0<<+  <<P  8=8=X @ 8=8=@ @ ==|  ==H @ ==  ==  `=`= @ `=`=  `=`=  0<< @ 0<<(  <<  <<  <<+  <<+ @ << @ <<+ @ <<+ @@ `=`=, P@ x<x<, @ `=`=, P x<x< @ PPP,  @D<D< ,  P<<(,0,$$8,1@,"2H,23P,$b6``X,$8```, qqh, qqp,x,c&##,c&"",c&"",cc,cs,0%%,8%%,  HH,  HH,   HH,  HH,  HH,  HH,D  oo,D oo,Y3#,3#||- @ @@- @ 88-)-) -q(- q0-b8- a @-bH- a P-b X- a  `-bddh- a ddp-b!ddx- a !dd-bPКК- a PКК-bQКК- a QКК-b+- a+-b+@@- a+@@-b*- a*-b*- a*-b* - a* -b*- a*.b. a .pp. pp . pp(.  pp0.0pp8. 0pp@.bH. a P.bX. a `.b!h. a !p.b# %%x. a# %%.b# %%. a# %%.b# %%. a# %%.b# %%. a# %%.b#|%|%. a#|%|%. ` A. ` Q. a'"". a'"". ` 1ܘܘ. a a. a q.b/ a / a'##/b'!!/ a'!!$/b'!!0/ a'!! > $>E(>    8 $?(?0,?0?4? (8?? @@Ȧ @ @ $@ (@,@0@ 4@8@<@ @@D@H@ L@P@ T@ X@ \@`@ d@h@l@ p@t@x@ |@@@ @@ @ @ @@ @@@@@@@@@@@@@A AAA$A,A4A, unwind opcode too longinvalid unwind opcodeunexpected character `%c' in type specifierbad size %d in type specifieruse of r15 in bx in ARM mode is not really usefuluse of r15 in bxj is not really usefulrdhi and rdlo must be differentRd and Rm should be different in mlainstruction does not support unindexed addressingpc may not be used with write-backinstruction does not support writebackthis instruction does not support indexingInstruction does not support =N addressescannot use register index with PC-relative addressingcannot use register index with this instructionThumb does not support negative register indexingThumb does not support register post-indexingThumb does not support register indexing with writebackThumb supports only LSL in shifted register indexingshift out of rangecannot use writeback with PC-relative addressingcannot use writeback with this instructioncannot use post-indexing with PC-relative addressingcannot use post-indexing with this instructioninstruction does not accept unindexed addressingsoftfpaunknown floating point format `%s' armv1unknown architecture `%s' cryptonoarchitectural extension `%s' is not allowed for the current base architecture.gnu.linkonce.armexidx..ARM.exidx.gnu.linkonce.armextab..ARM.extab.gnu.linkonce.t.Group section `%s' has no group signatureduplicate .personality directiveinstruction does not accept preindexed addressingdestination register same as write-back basesource register same as write-back baseinstruction does not accept scaled register indexuse of PC in this instruction is deprecatedr12 not allowed herebase register written back, and overlaps one of transfer registersfirst transfer register must be evencan only transfer two consecutive registers'[' expectedbase register written back, and overlaps second transfer registerindex register overlaps transfer registerRn must not overlap other operandsswp{b} use is obsoleted for ARMv8 and laterswp{b} use is deprecated for ARMv6 and ARMv7arm1unknown cpu `%s'unifieddividedunrecognized syntax mode "%s"alignment too large: %d assumedalignment negative. 0 assumed.ffmasffnmasffmadffnmadoperands 0 and 1 must be the same registerUse of PC here is deprecatedUse of PC here is UNPREDICTABLEflddfstdfldsfstsfaddsfsubsfadddfsubdfmacsfnmacsfmacdfnmacdfmulsfmuldfldmiasfldmiadfstmdbsfstmdbdinvalid syntax for .unreq directiveunknown register alias '%s'ignoring attempt to use .unreq on fixed register name: '%s'invalid instruction shapeunsupported alignment for instructionscalar out of range for multiply instructionwriteback of base register is UNPREDICTABLEwriteback of base register when in register list is UNPREDICTABLEif writeback register is in list, it must be the lowest reg in the listinvalid architectural extensionmust specify extensions to add before specifying those to removemissing architectural extensionextension does not apply to the base architectureunknown architectural extension `%s'architectural extensions must be specified in alphabetical ordermissing architecture name `%s'missing cpu name `%s'types specified in both the mnemonic and operandsoperand types can't be inferredtype specifier has the wrong number of partsoperand size must match register widthbad type in Neon instructioninconsistent types in Neon instructionbad list length for table lookupftosizsftouizsftosizdftouizdfnegsfabssfnegdfabsdfdivsfdivdfsqrtsfsqrtdbad alignmentbad list type for instructionbad list lengthcan't use alignment with this instructionscalar index out of rangestride of 2 unavailable when element size is 8post-index must be a registerbad register for post-indexfldmdbsfstmiaswriteback (!) must be used for VLDMDB and VSTMDBregister list must contain at least 1 and at most 16 registersimmediate out of rangeimmediate out of range for narrowing operationthe only valid suffixes here are '(plt)' and '(tlscall)'immediate operand requires iWMMXt2only r15 allowed hereimmediate value out of range, expected range [0, 16]immediate value out of range, expected range [1, 32]:upper16: not allowed instructionSMC is not permitted on this architecturer14 not allowed as first register when second register is omittedcan only load two consecutive registersSRS base register must be r13extraneous shift as part of operand to shift insnldr to register 15 must be 4-byte allignedonly two consecutive VFP SP registers allowed herethis addressing mode requires base-register writebackoperand size must be specified for immediate VMOVimmediate has bits set outside the operand sizefconstdfconstsfcpydbad type for scalarfcpysfmrsfmsrVFP registers must be adjacentfmrrsfmsrrimmediate out of range for shiftfirst and second operands shall be the same registerexpected #constantstack increment must be multiple of 4expected , register must be either sp or set by a previousunwind_movsp directiveARM register expectedSP and PC not permitted in .unwind_movsp directiveunexpected .unwind_movsp directiveuse of r15 in blx in ARM mode is not really usefulrdhi, rdlo and rm must all be differentRd and Rm should be different in mulimmediate expression requires a # prefixinvalid constantbad range in register listWarning: duplicated register (r%d) in register listWarning: register range not in ascending ordermissing `}'invalid register maskonly one type should be specified for operandvector type expectedcan't redefine type for operandonly D registers may be indexedcan't change index for operandconstant expression requiredshift expression expected'LSL' or 'ASR' required'LSL' required'ASR' requiredregister operand expected, but got scalarexpecting {register out of range in listinvalid register listregister list not in ascending orderregister range not in ascending ordernon-contiguous register rangeFPA .unwind_save does not take a register listexpected , number of registers must be in the range [1:4]expected register listiWMMXt data register expectedbad register rangeiWMMXt scalar register expected.unwind_save does not support this kind of registeralignment must be constantunknown group relocationthis group relocation is not allowed on this instructioncannot combine index with optioncannot combine pre- and post-indexing']' expected'}' expected at end of 'option' fieldconstant expression expectedinvalid rotationselected processor does not support THUMB opcodesselected processor does not support ARM opcodesinvalid instruction size selected (%d)invalid operand to .code directive (%d) (expecting 16 or 32)duplicate .fnstart directivethumbalwaysneverunknown implicit IT mode `%s', should be arm, thumb, always, or never.gnuunknown EABI `%s' hardunknown floating point abi `%s' '[' expected after PLI mnemonicpost-indexed expression used in preload instructionwriteback used in preload instructionunindexed addressing used in preload instruction'[' expected after PLD mnemonicthis instruction requires a post-indexed addresssetend use is deprecated for ARMv8fmxrThumb encoding does not support an immediate hereselected processor does not support requested special purpose registeroperand 1 must be FPSCRfmstatfmrxbad register for mrs'APSR', 'CPSR' or 'SPSR' expectedignoring attempt to redefine built-in register '%s'ignoring redefinition of register alias '%s' .req unknown register '%s' -- .req ignoredattempt to redefine typed alias .dn .qn bad type for registerexpression must be constantcan't redefine the type of a register aliasyou must specify a single type onlycan't redefine the index of a scalar aliasscalar index must be constantexpecting ]immediate out of range for insertelements must be smaller than reversal regionInstruction form not available on this architecture.invalid pseudo operationliteral pool overflowliteral pool insertion failedscalar must have an indexbad or missing co-processor numberco-processor register expectedFPA register expectedVFP single precision register expectedVFP/Neon double precision register expectedMaverick MVF register expectedMaverick MVD register expectedMaverick MVFX register expectedMaverick MVDX register expectedMaverick MVAX register expectedMaverick DSPSC register expectediWMMXt control register expectedXScale accumulator register expectedNeon quad precision register expectedNeon double or quad precision register expectedVFP single or double precision register expectedVFP single, double or Neon quad precision register expectedcan't use Neon quad register here0xexpected or or operandparse errorimmediate value is out of rangeunrecognized relocation suffix:lower16::upper16:invalid FPA immediate expressioniWMMXt data or control register expectedunrecognized CPS flagmissing CPS flagsBELEvalid endian specifiers are be or leRORmissing rotation field after commarotation can only be 0, 8, 16, or 24condition requiredinvalid barrier typeBanked registers are not available with this architecture.iapsreapsrxpsrpsrunexpected bit specified after APSRselected processor does not support DSP extensionbad bitmask specified after APSRwriting to APSR without specifying a bitmask is deprecatedflag for {c}psr instruction expectedAPSR_invalid shiftregister stride must be 1 or 2mismatched element/structure types in listdon't use Rn-Rm syntax with non-unit strideerror parsing element/structure listunhandled operand code %dbad arguments to instructionsyntax errorgarbage following instructionSPSR',' expectedexpected }CPSR(plt) is only valid on branch targets%s relocations do not fit in %d bytesdata:/data$$lit_%xUnrecognized or unsupported floating point constanthandlerdata in cantunwind frametoo many unwind opcodes for personality routine 0too many unwind opcodesduplicate .handlerdata directive.fnend directive without .fnstartmissing commaWarning: conditional outside an IT block for Thumb.thumb conditional instruction should be in IT blockinstruction not allowed in IT blockincorrect condition in IT blockbranch must be last instruction in IT blockIT falling in the range of a previous IT blockit blocks containing wide Thumb instructions are deprecated in ARMv8it blocks containing 16-bit Thumb intsructions of the following class are deprecated in ARMv8: %sit blocks of more than one conditional instruction are deprecated in ARMv8width suffixes are invalid in ARM mode.inst.n operand too big. Use .inst.w insteadcannot determine Thumb instruction size. Use .inst.n/.inst.w insteadinstruction not supported in Thumb16 modedest must overlap one source registerThumb-2 MUL must not set flagssource1 and dest must be same registerror #imm not supportedunshifted register requireddest and source1 must be the same registerinvalid rounding modeinstruction is always unconditionalinstruction requires register indexinstruction does not allow shifted indexselected processor does not support 'A' form of this instructionThumb does not support the 2-argument form of this instructionSP not allowed in register listhaving the base register in the register list when using write back is UNPREDICTABLELR and PC should not both be in register listPC not allowed in register listpush/pop do not support {reglist}^invalid register list to push/pop instructionThumb load/store multiple does not support {reglist}^value stored for r%d is UNKNOWNThumb-2 instruction only valid in unified syntaxthis instruction will write back the base registerthis instruction will not write back the base registerThumb does not support NOP with hintsThis instruction may be unpredictable if executed on M-profile cores with interrupts enabled.Thumb does not support this addressing modebyte or halfword not valid for base registerr15 based store not allowedinvalid base register for register offsetuse of r13 is deprecatedUse of r%u as a source register is deprecated when r%u is the destination register.MOV Rd, Rs with two low registers is not permitted on this architectureshifts in CMP/MOV instructions are only supported in unified syntaxonly lo regs allowed with immediateonly SUBS PC, LR, #const allowedshift value over 3 not allowed in thumb modeonly LSL shift allowed in thumb modeconditional infixes are deprecated in unified syntaxbad instruction `%s's suffix on comparison instruction is deprecatedselected processor does not support Thumb mode `%s'Thumb does not support conditional executionselected processor does not support Thumb-2 mode `%s'cannot honor width suffix -- `%s'invalid neon suffix for non neon instructionselected processor does not support ARM mode `%s'width suffixes are invalid in ARM mode -- `%s'attempt to use an ARM instruction on a Thumb-only processor -- `%s'%s -- `%s'alignments greater than %d bytes not supported in .text sections.exidx_GLOBAL_OFFSET_TABLE_GOT already in the symbol tableexpected comma after name "%s"symbol `%s' already definedundefined symbol %s used as an immediate valuesymbol %s is in a different sectionsymbol %s is weak and may be overridden laterinvalid constant (%lx) after fixupunable to compute ADRL instructions for PC offset of 0x%lxinvalid literal constant: pool needs to be closerbad immediate value for offset (%ld)bad immediate value for 8-bit offset (%ld)offset not a multiple of 4offset out of rangeinvalid smc expressioninvalid hvc expressioninvalid swi expressioninvalid expression in load/store multipleblx to '%s' an ARM ISA state function changed to blmisaligned branch destinationconditional branch out of rangeblx to Thumb func '%s' from Thumb ISA state changed to blThumb2 branch out of rangerel31 relocation overflowco-processor offset out of rangeinvalid offset, target not word aligned (0x%08lX)invalid offset, value too big (0x%08lX)Unable to process relocation for thumb opcode: %lxinvalid Hi register with immediateinvalid immediate for stack address calculationinvalid immediate for address calculation (value = 0x%08lX)invalid immediate: %ld is out of rangeinvalid shift value: %ldthe offset 0x%08lX is not representablebad offset 0x%08lX (only 12 bits available for the magnitude)bad offset 0x%08lX (only 8 bits available for the magnitude)bad offset 0x%08lX (must be word-aligned)bad offset 0x%08lX (must be an 8-bit number of words)bad relocation fixup type (%d)NONEOFFSET_IMM8SHIFT_IMMSMCSWIMULTIT32_OFFSET_IMMT32_CP_OFF_IMMTHUMB_ADDTHUMB_SHIFTTHUMB_IMMTHUMB_OFFSETliteral referenced across section boundaryinternal relocation (type: IMMEDIATE) not fixed upADRL used for a symbol not defined in the same fileundefined local label `%s'internal_relocation (type: OFFSET_IMM) not fixed upcannot represent %s relocation in this object file formatelf32-bigarmelf32-littlearmsection '%s' finished with an open IT block.virtual memory exhausteduse of old and new-style options to set CPU typeuse of old and new-style options to set FPU typehard-float conflicts with specified fpu.arm.atpcsmarm1option `-%c%s' is deprecated: %s ARM-specific assembler options: -%-23s%s -EB assemble code for a big-endian cpu -EL assemble code for a little-endian cpu --fix-v4bx Allow BX in ARMv4 code -%s%s armvTag_CPU_raw_nameTag_CPU_nameTag_CPU_archTag_CPU_arch_profileTag_ARM_ISA_useTag_THUMB_ISA_useTag_FP_archTag_VFP_archTag_WMMX_archTag_Advanced_SIMD_archTag_PCS_configTag_ABI_PCS_R9_useTag_ABI_PCS_RW_dataTag_ABI_PCS_RO_dataTag_ABI_PCS_GOT_useTag_ABI_PCS_wchar_tTag_ABI_FP_roundingTag_ABI_FP_denormalTag_ABI_FP_exceptionsTag_ABI_FP_user_exceptionsTag_ABI_FP_number_modelTag_ABI_align_neededTag_ABI_align8_neededTag_ABI_align_preservedTag_ABI_align8_preservedTag_ABI_enum_sizeTag_ABI_HardFP_useTag_ABI_VFP_argsTag_ABI_WMMX_argsTag_ABI_optimization_goalsTag_ABI_FP_optimization_goalsTag_compatibilityTag_CPU_unaligned_accessTag_FP_HP_extensionTag_VFP_HP_extensionTag_ABI_FP_16bit_formatTag_MPextension_useTag_DIV_useTag_nodefaultsTag_also_compatible_withTag_conformanceTag_T2EE_useTag_Virtualization_useftosisftouisfsitosfuitosfcvtsdfcvtdsftosidftouidfsitodfuitodftoslsftoulsfsltosfultosftosldftouldfsltodfultodfshtosfuhtosfshtodfuhtodftoshsftouhsftoshdftouhd__aeabi_unwind_cpp_pr0__aeabi_unwind_cpp_pr1__aeabi_unwind_cpp_pr2mcpu= assemble for CPU march= assemble for architecture mfpu= assemble for FPU architecture mfloat-abi= assemble for floating point ABI meabi= assemble for eabi version mimplicit-it= controls implicit insertion of IT instructionssoftfpsoftfpefpe2fpe3fpa10fpa11arm7500fesoftvfpsoftvfp+vfpvfp9vfp3vfp10vfp10-r0vfpxdvfpv2vfpv3vfpv3-fp16vfpv3-d16vfpv3-d16-fp16vfpv3xdvfpv3xd-fp16arm1020tarm1020earm1136jfsarm1136jf-smaverickneonneon-fp16vfpv4vfpv4-d16fpv4-sp-d16neon-vfpv4neon-fp-armv8crypto-neon-fp-armv8idiviwmmxtiwmmxt2mpsimdsecvirtxscalearmv2armv2aarmv2sarmv3armv3marmv4armv4xmarmv4tarmv4txmarmv5armv5earmv5tarmv5txmarmv5tearmv5texparmv5tejarmv6armv6jarmv6karmv6zarmv6zkarmv6t2armv6kt2armv6zt2armv6zkt2armv6-marmv6s-marmv7armv7aarmv7rarmv7marmv7-aarmv7-rarmv7-marmv7e-marmv8-aarm2arm250arm3arm6arm60arm600arm610arm620arm7arm7marm7darm7dmarm7diarm7dmiarm70arm700arm700iarm710arm710tarm720arm720tarm740tarm710carm7100arm7500arm7tarm7tdmiarm7tdmi-sarm8arm810strongarmstrongarm1strongarm110strongarm1100strongarm1110arm9arm920ARM920Tarm920tarm922tarm940tarm9tdmifa526fa626arm9e-r0arm9earm926ejARM926EJ-Sarm926ejsarm926ej-sarm946e-r0arm946eARM946E-Sarm946e-sarm966e-r0arm966eARM966E-Sarm966e-sarm968e-sarm10tarm10tdmiarm10earm1020ARM1020Earm1022earm1026ejsARM1026EJ-Sarm1026ej-sfa606tefa616tefa626tefmp626fa726tearm1136jsARM1136J-Sarm1136j-sARM1136JF-SmpcoreMPCorempcorenovfparm1156t2-sarm1156t2f-sarm1176jz-sarm1176jzf-scortex-a5Cortex-A5cortex-a7Cortex-A7cortex-a8Cortex-A8cortex-a9Cortex-A9cortex-a15Cortex-A15cortex-r4Cortex-R4cortex-r4fCortex-R4Fcortex-r5Cortex-R5cortex-r7Cortex-R7cortex-m4Cortex-M4cortex-m3Cortex-M3cortex-m1Cortex-M1cortex-m0Cortex-M0cortex-m0plusCortex-M0+i80200ep9312use -mcpu=arm1marm2use -mcpu=arm2marm250use -mcpu=arm250marm3use -mcpu=arm3marm6use -mcpu=arm6marm600use -mcpu=arm600marm610use -mcpu=arm610marm620use -mcpu=arm620marm7use -mcpu=arm7marm70use -mcpu=arm70marm700use -mcpu=arm700marm700iuse -mcpu=arm700imarm710use -mcpu=arm710marm710cuse -mcpu=arm710cmarm720use -mcpu=arm720marm7duse -mcpu=arm7dmarm7diuse -mcpu=arm7dimarm7muse -mcpu=arm7mmarm7dmuse -mcpu=arm7dmmarm7dmiuse -mcpu=arm7dmimarm7100use -mcpu=arm7100marm7500use -mcpu=arm7500marm7500feuse -mcpu=arm7500femarm7tuse -mcpu=arm7tdmim7tmarm7tdmimarm710tuse -mcpu=arm710tmarm720tuse -mcpu=arm720tmarm740tuse -mcpu=arm740tmarm8use -mcpu=arm8marm810use -mcpu=arm810marm9use -mcpu=arm9marm9tdmiuse -mcpu=arm9tdmimarm920use -mcpu=arm920marm940use -mcpu=arm940mstrongarmuse -mcpu=strongarmmstrongarm110use -mcpu=strongarm110mstrongarm1100use -mcpu=strongarm1100mstrongarm1110use -mcpu=strongarm1110mxscaleuse -mcpu=xscalemiwmmxtuse -mcpu=iwmmxtmalluse -mcpu=allmv2use -march=armv2marmv2mv2ause -march=armv2amarmv2amv3use -march=armv3marmv3mv3muse -march=armv3mmarmv3mmv4use -march=armv4marmv4mv4tuse -march=armv4tmarmv4tmv5use -march=armv5marmv5mv5tuse -march=armv5tmarmv5tmv5euse -march=armv5temarmv5emfpe-olduse -mfpu=fpemfpa10use -mfpu=fpa10mfpa11use -mfpu=fpa11mno-fpuuse either -mfpu=softfpa or -mfpu=softvfpgenerate PIC codemthumbassemble Thumb codemthumb-interworksupport ARM/Thumb interworkingmapcs-32code uses 32-bit program countermapcs-26code uses 26-bit program countermapcs-floatfloating point args are in fp regsmapcs-reentrantre-entrant codematpcscode is ATPCS conformantmbig-endianassemble for big-endianmlittle-endianassemble for little-endianmapcs-frameuse frame pointermapcs-stack-checkuse stack size checkingmwarn-deprecatedmno-warn-deprecateddo not warn on use of deprecated featureEBELfix-v4bxm:kandseoreorssubsubsaddaddsadcadcssbcsbcsorrorrsbicbicststtstststpcmpcmpscmppcmncmnscmnpmovmovsmvnmvnsldrldrbstrbstmstmiastmealdmldmialdmfdswisvcbladradrlnoplslslsrlsrsasrasrsnegnegspushpoprsbrsbscpyteqteqsteqpldrtldrbtstrtstrbtstmdbstmfdldmdbldmearscrscsstmibstmfastmdastmedldmibldmedldmdaldmfamulmulsmlamlascdpldcldclstcstclmcrmrcswpswpbmrsmsrsmullsmullssmulleqssmullnessmullcsssmullhsssmullccssmullulssmulllossmullmissmullplssmullvsssmullvcssmullhissmulllsssmullgessmullltssmullgtssmulllessmullalsumullumullsumulleqsumullnesumullcssumullhssumullccsumullulsumulllosumullmisumullplsumullvssumullvcsumullhisumulllssumullgesumullltsumullgtsumulllesumullalssmlalsmlalssmlaleqssmlalnessmlalcsssmlalhsssmlalccssmlalulssmlallossmlalmissmlalplssmlalvsssmlalvcssmlalhissmlallsssmlalgessmlalltssmlalgtssmlallessmlalalsumlalumlalsumlaleqsumlalnesumlalcssumlalhssumlalccsumlalulsumlallosumlalmisumlalplsumlalvssumlalvcsumlalhisumlallssumlalgesumlalltsumlalgtsumlallesumlalalsldrhstrhldrshldrsbldshldeqshldneshldcsshldhsshldccshldulshldloshldmishldplshldvsshldvcshldhishldlsshldgeshldltshldgtshldleshldalshldsbldeqsbldnesbldcssbldhssbldccsbldulsbldlosbldmisbldplsbldvssbldvcsbldhisbldlssbldgesbldltsbldgtsbldlesbldalsbbxblxbkptclzldc2ldc2lstc2stc2lcdp2mcr2mrc2smlabbsmlatbsmlabtsmlattsmlawbsmlawtsmlalbbsmlaltbsmlalbtsmlalttsmulbbsmultbsmulbtsmulttsmulwbsmulwtqaddqdaddqsubqdsubpldldrdstrdmcrrmrrcbxjcpsiecpsidrevrev16revshsxthuxthsxtbuxtbsetendldrexstrexmcrr2mrrc2ssatusatrfeiarferfeibrfedarfedbrfefdrfefarfeearfeedsrsiasrssrseasrsibsrsfasrsdasrsedsrsdbsrsfdcpspkhbtpkhtbqadd16qadd8qasxqaddsubxqsaxqsubaddxqsub16qsub8sadd16sadd8sasxsaddsubxshadd16shadd8shasxshaddsubxshsaxshsubaddxshsub16shsub8ssaxssubaddxssub16ssub8uadd16uadd8uasxuaddsubxuhadd16uhadd8uhasxuhaddsubxuhsaxuhsubaddxuhsub16uhsub8uqadd16uqadd8uqasxuqaddsubxuqsaxuqsubaddxuqsub16uqsub8usub16usaxusubaddxusub8sxtahsxtab16sxtabsxtb16uxtahuxtab16uxtabuxtb16selsmladsmladxsmlaldsmlaldxsmlsdsmlsdxsmlsldsmlsldxsmmlasmmlarsmmlssmmlsrsmmulsmmulrsmuadsmuadxsmusdsmusdxssat16umaalusad8usada8usat16yieldwfewfisevldrexdstrexdldrexbldrexhstrexbstrexhclrexsmchvceretbfcbfisbfxubfxmlsmovwmovtrbitldrhtldrshtldrsbtstrhtcbnzcbzittiteitttitetitteiteeittttitettittetiteetittteiteteitteeiteeerrxrrxsaddwsubwornornstbbtbhsdivudivdmbdsbisbplidbgpldwsevlhltldaexldaexdldaexbldaexhstlexstlexdstlexbstlexhldaldabldahstlstlbstlhdcps1dcps2dcps3vseleqvselvsvselgevselgtvmaxnmvminnmvcvtavcvtnvcvtpvcvtmvrintrvrintzvrintxvrintavrintnvrintpvrintmaeseaesdaesmcaesimcsha1csha1psha1msha1su0sha256hsha256h2sha256su1sha1hsha1su1sha256su0wfsrfswfcrfcldfsldfdldfeldfpstfsstfdstfestfpmvfsmvfspmvfsmmvfszmvfdmvfdpmvfdmmvfdzmvfemvfepmvfemmvfezmnfsmnfspmnfsmmnfszmnfdmnfdpmnfdmmnfdzmnfemnfepmnfemmnfezabssabsspabssmabsszabsdabsdpabsdmabsdzabseabsepabsemabsezrndsrndsprndsmrndszrnddrnddprnddmrnddzrnderndeprndemrndezsqtssqtspsqtsmsqtszsqtdsqtdpsqtdmsqtdzsqtesqtepsqtemsqtezlogslogsplogsmlogszlogdlogdplogdmlogdzlogelogeplogemlogezlgnslgnsplgnsmlgnszlgndlgndplgndmlgndzlgnelgneplgnemlgnezexpsexpspexpsmexpszexpdexpdpexpdmexpdzexpeexpepexpemsinssinspsinsmsinszsindsindpsindmsindzsinesinepsinemsinezcosscosspcossmcosszcosdcosdpcosdmcosdzcosecosepcosemcoseztanstansptansmtansztandtandptandmtandztanetaneptanemtanezasnsasnspasnsmasnszasndasndpasndmasndzasneasnepasnemasnezacssacsspacssmacsszacsdacsdpacsdmacsdzacseacsepacsemacsezatnsatnspatnsmatnszatndatndpatndmatndzatneatnepatnematnezurdsurdspurdsmurdszurddurddpurddmurddzurdeurdepurdemurdeznrmsnrmspnrmsmnrmsznrmdnrmdpnrmdmnrmdznrmenrmepnrmemnrmezadfsadfspadfsmadfszadfdadfdpadfdmadfdzadfeadfepadfemadfezsufssufspsufsmsufszsufdsufdpsufdmsufdzsufesufepsufemsufezrsfsrsfsprsfsmrsfszrsfdrsfdprsfdmrsfdzrsfersfeprsfemrsfezmufsmufspmufsmmufszmufdmufdpmufdmmufdzmufemufepmufemmufezdvfsdvfspdvfsmdvfszdvfddvfdpdvfdmdvfdzdvfedvfepdvfemdvfezrdfsrdfsprdfsmrdfszrdfdrdfdprdfdmrdfdzrdferdfeprdfemrdfezpowspowsppowsmpowszpowdpowdppowdmpowdzpowepoweppowempowezrpwsrpwsprpwsmrpwszrpwdrpwdprpwdmrpwdzrpwerpweprpwemrpwezrmfsrmfsprmfsmrmfszrmfdrmfdprmfdmrmfdzrmfermfeprmfemrmfezfmlsfmlspfmlsmfmlszfmldfmldpfmldmfmldzfmlefmlepfmlemfmlezfdvsfdvspfdvsmfdvszfdvdfdvdpfdvdmfdvdzfdvefdvepfdvemfdvezfrdsfrdspfrdsmfrdszfrddfrddpfrddmfrddzfrdefrdepfrdemfrdezpolspolsppolsmpolszpoldpoldppoldmpoldzpolepoleppolempolezcmfcmfecnfcnfefltsfltspfltsmfltszfltdfltdpfltdmfltdzfltefltepfltemfltezfixfixpfixmfixzfixspfixsmfixszfixdpfixdmfixdzfixepfixemfixezlfmlfmfdlfmeasfmsfmfdsfmeavmrsvmsrfldmfdsfldmeasfldmiaxfldmfdxfldmdbxfldmeaxfstmeasfstmfdsfstmiaxfstmeaxfstmdbxfstmfdxfmscsfnmulsfnmscsfcmpsfcmpzsfcmpesfcmpezsfldmfddfldmdbdfldmeadfstmiadfstmeadfstmfddfmdhrfmdlrfmrdhfmrdlfmscdfnmuldfnmscdfcmpdfcmpzdfcmpedfcmpezdfmdrrfmrrdvsqrtvdivvnmulvnmlavnmlsvcmpvcmpevpushvpopvcvtzvmulvmlavmlsvaddvsubvabsvnegvldmvldmiavldmdbvstmvstmiavstmdbvldrvstrvcvtvcvtrvcvtbvcvttvmovvmovqvabavabaqvhaddvhaddqvrhaddvrhaddqvhsubvhsubqvqaddvqaddqvqsubvqsubqvrshlvrshlqvqrshlvqrshlqvshlvshlqvqshlvqshlqvandvandqvbicvbicqvorrvorrqvornvornqveorveorqvbslvbslqvbitvbitqvbifvbifqvabdvabdqvmaxvmaxqvminvminqvcgevcgeqvcgtvcgtqvcltvcltqvclevcleqvceqvceqqvpmaxvpminvmlaqvmlsqvpaddvaddqvsubqvtstvtstqvmulqvqdmulhvqdmulhqvqrdmulhvqrdmulhqvacgevacgeqvacgtvacgtqvacltvacltqvaclevacleqvrecpsvrecpsqvrsqrtsvrsqrtsqvabsqvnegqvshrvshrqvrshrvrshrqvsravsraqvrsravrsraqvslivsliqvsrivsriqvqshluvqshluqvqshrnvqrshrnvqshrunvqrshrunvshrnvrshrnvshllvcvtqvmvnvmvnqvabalvabdlvaddlvsublvmlalvmlslvaddwvsubwvaddhnvraddhnvsubhnvrsubhnvqdmlalvqdmlslvqdmullvmullvextvextqvrev64vrev64qvrev32vrev32qvrev16vrev16qvdupvdupqvmovlvmovnvqmovnvqmovunvzipvzipqvuzpvuzpqvqabsvqabsqvqnegvqnegqvpadalvpadalqvpaddlvpaddlqvrecpevrecpeqvrsqrtevrsqrteqvclsvclsqvclzvclzqvcntvcntqvswpvswpqvtrnvtrnqvtblvtbxvld1vst1vld2vst2vld3vst3vld4vst4vfmavfmsvfnmavfnmsmiamiaphmiabbmiabtmiatbmiattmarmratandcbtandchtandcwtbcstbtbcsthtbcstwtextrcbtextrchtextrcwtextrmubtextrmuhtextrmuwtextrmsbtextrmshtextrmswtinsrbtinsrhtinsrwtmcrtmcrrtmiatmiaphtmiabbtmiabttmiatbtmiatttmovmskbtmovmskhtmovmskwtmrctmrrctorcbtorchtorcwwaccbwacchwaccwwaddbsswaddbwaddbuswaddhsswaddhwaddhuswaddwsswaddwwaddwuswaligniwalignr0walignr1walignr2walignr3wandwandnwavg2bwavg2brwavg2hwavg2hrwcmpeqbwcmpeqhwcmpeqwwcmpgtubwcmpgtuhwcmpgtuwwcmpgtsbwcmpgtshwcmpgtswwldrbwldrhwldrwwldrdwmacswmacszwmacuwmacuzwmaddswmadduwmaxsbwmaxshwmaxswwmaxubwmaxuhwmaxuwwminsbwminshwminswwminubwminuhwminuwwmovwmulsmwmulslwmulumwmululworwpackhsswpackhuswpackwsswpackwuswpackdsswpackduswrorhwrorhgwrorwwrorwgwrordwrordgwsadbwsadbzwsadhwsadhzwshufhwsllhwsllhgwsllwwsllwgwslldwslldgwsrahwsrahgwsrawwsrawgwsradwsradgwsrlhwsrlhgwsrlwwsrlwgwsrldwsrldgwstrbwstrhwstrwwstrdwsubbsswsubbwsubbuswsubhsswsubhwsubhuswsubwsswsubwwsubwuswunpckehubwunpckehuhwunpckehuwwunpckehsbwunpckehshwunpckehswwunpckihbwunpckihhwunpckihwwunpckelubwunpckeluhwunpckeluwwunpckelsbwunpckelshwunpckelswwunpckilbwunpckilhwunpckilwwxorwzerotorvscbtorvschtorvscwwabsbwabshwabswwabsdiffbwabsdiffhwabsdiffwwaddbhuslwaddbhusmwaddhcwaddwcwaddsubhxwavg4wavg4rwmaddsnwmaddsxwmaddunwmadduxwmergewmiabbwmiabtwmiatbwmiattwmiabbnwmiabtnwmiatbnwmiattnwmiawbbwmiawbtwmiawtbwmiawttwmiawbbnwmiawbtnwmiawtbnwmiawttnwmulsmrwmulumrwmulwumrwmulwsmrwmulwumwmulwsmwmulwlwqmiabbwqmiabtwqmiatbwqmiattwqmiabbnwqmiabtnwqmiatbnwqmiattnwqmulmwqmulmrwqmulwmwqmulwmrwsubaddhxcfldrscfldrdcfldr32cfldr64cfstrscfstrdcfstr32cfstr64cfmvsrcfmvrscfmvdlrcfmvrdlcfmvdhrcfmvrdhcfmv64lrcfmvr64lcfmv64hrcfmvr64hcfmval32cfmv32alcfmvam32cfmv32amcfmvah32cfmv32ahcfmva32cfmv32acfmva64cfmv64acfmvsc32cfmv32sccfcpyscfcpydcfcvtsdcfcvtdscfcvt32scfcvt32dcfcvt64scfcvt64dcfcvts32cfcvtd32cftruncs32cftruncd32cfrshl32cfrshl64cfsh32cfsh64cfcmpscfcmpdcfcmp32cfcmp64cfabsscfabsdcfnegscfnegdcfaddscfadddcfsubscfsubdcfmulscfmuldcfabs32cfabs64cfneg32cfneg64cfadd32cfadd64cfsub32cfsub64cfmul32cfmul64cfmac32cfmsc32cfmadd32cfmsub32cfmadda32cfmsuba32sySYLDishISHSHishstISHSTshstSHSTishldISHLDunUNnshNSHunstUNSTnshstNSHSTnshldNSHLDoshOSHoshstOSHSToshldOSHLDccloplhigotGOTgotoffGOTOFFpltPLTtarget1TARGET1target2TARGET2sbrelSBRELtlsgdTLSGDtlsldmTLSLDMtlsldoTLSLDOgottpoffGOTTPOFFtpoffTPOFFgot_prelGOT_PRELtlsdescTLSDESCtlscallTLSCALLtlsdescseqTLSDESCSEQaslASLLSLLSRASRRRXapsrIAPSREAPSRXPSRxPSRipsrIPSRepsrEPSRiepsrIEPSRmspMSPpspPSPprimaskPRIMASKbasepriBASEPRIbasepri_maxBASEPRI_MAXBASEPRI_MASKfaultmaskFAULTMASKcontrolCONTROLflgctlfxfcsfsxscxfxsxccfcxfsxfscfxsfxcfcsfcxsfxsfcsxfsxcscfscxxfsxfcxsfxscxcfxcscfscfxcsfcsxcxfcxsfsxcfscxfxscfxcsfcsxfcxssfxcsfcxsxfcsxcfscfxscxfxfscxfcsxsfcxscfxcfsxcsfcfsxcfxscsfxcsxfcxfscxsfr3r4r5r6r7r8r9r10r11r12r13r14r15R0R1R2R3R4R5R6R7R8R9R10R11R12R13R14R15a1a2a3a4v1v6v7A1A2A3A4V1V2V3V4V5V6V7V8wripspWRSBSLFPIPSPLRPCp0p1p2p3p4p5p6p7p8p9p10p11p12p13p14p15P0P1P2P3P4P5P6P7P8P9P10P11P12P13P14P15c0c1c2c3c4c5c6c7c8c9c10c11c12c13c14c15C0C1C2C3C4C5C6C7C8C9C10C11C12C13C14C15cr0cr1cr2cr3cr4cr5cr6cr7cr8cr9cr10cr11cr12cr13cr14cr15CR0CR1CR2CR3CR4CR5CR6CR7CR8CR9CR10CR11CR12CR13CR14CR15R8_usrr8_usrR9_usrr9_usrR10_usrr10_usrR11_usrr11_usrR12_usrr12_usrSP_usrsp_usrLR_usrlr_usrR8_fiqr8_fiqR9_fiqr9_fiqR10_fiqr10_fiqR11_fiqr11_fiqR12_fiqr12_fiqSP_fiqLR_fiqlr_fiqSPSR_fiqspsr_fiqlr_IRQsp_IRQspsr_IRQLR_IRQSP_IRQSPSR_IRQlr_irqsp_irqspsr_irqLR_irqSP_irqSPSR_irqlr_SVCsp_SVCspsr_SVCLR_SVCSP_SVCSPSR_SVClr_svcsp_svcspsr_svcLR_svcSP_svcSPSR_svclr_ABTsp_ABTspsr_ABTLR_ABTSP_ABTSPSR_ABTlr_abtsp_abtspsr_abtLR_abtSP_abtSPSR_abtlr_UNDsp_UNDspsr_UNDLR_UNDSP_UNDSPSR_UNDlr_undsp_undspsr_undLR_undSP_undSPSR_undlr_MONsp_MONspsr_MONLR_MONSP_MONSPSR_MONlr_monsp_monspsr_monLR_monSP_monSPSR_monelr_hypELR_hypsp_hypSP_hypspsr_hypSPSR_hypf0f1f2f3f4f5f6f7F0F1F2F3F4F5F6F7s0s1s2s3s4s5s6s7s8s9s10s11s12s13s14s15S0S1S2S3S4S5S6S7S8S9S10S11S12S13S14S15s16s17s18s19s20s21s22s23s24s25s26s27s28s29s30s31S16S17S18S19S20S21S22S23S24S25S26S27S28S29S30S31d0d1d2d3d4d5d6d7d9d10d11d12d13d14d15D0D1D2D3D4D5D6D7D8D9D10D11D12D13D14D15d17d18d19d20d21d22d23d24d25d26d27d28d29d30d31D16D17D18D19D20D21D22D23D24D25D26D27D28D29D30D31q0q1q2q3q4q5q6q7q8q9q10q11q12q13q14q15Q0Q1Q2Q3Q4Q5Q6Q7Q8Q9Q10Q11Q12Q13Q14Q15fpsidfpscrfpexcFPSIDFPSCRfpinstfpinst2FPINSTFPINST2mvfr0mvfr1MVFR0MVFR1mvf0mvf1mvf2mvf3mvf4mvf5mvf6mvf7mvf8mvf9mvf10mvf11mvf12mvf13mvf14mvf15mvd0mvd1mvd2mvd3mvd4mvd5mvd6mvd7mvd8mvd9mvd10mvd11mvd12mvd13mvd14mvd15mvfx0mvfx1mvfx2mvfx3mvfx4mvfx5mvfx6mvfx7mvfx8mvfx9mvfx10mvfx11mvfx12mvfx13mvfx14mvfx15mvdx0mvdx1mvdx2mvdx3mvdx4mvdx5mvdx6mvdx7mvdx8mvdx9mvdx10mvdx11mvdx12mvdx13mvdx14mvdx15MVF0MVF1MVF2MVF3MVF4MVF5MVF6MVF7MVF8MVF9MVF10MVF11MVF12MVF13MVF14MVF15MVD0MVD1MVD2MVD3MVD4MVD5MVD6MVD7MVD8MVD9MVD10MVD11MVD12MVD13MVD14MVD15MVFX0MVFX1MVFX2MVFX3MVFX4MVFX5MVFX6MVFX7MVFX8MVFX9MVFX10MVFX11MVFX12MVFX13MVFX14MVFX15MVDX0MVDX1MVDX2MVDX3MVDX4MVDX5MVDX6MVDX7MVDX8MVDX9MVDX10MVDX11MVDX12MVDX13MVDX14MVDX15mvax0mvax1mvax2mvax3dspscMVAX0MVAX1MVAX2MVAX3DSPSCwr0wr1wr2wr3wr4wr5wr6wr7wr8wr9wr10wr11wr12wr13wr14wr15wR0wR1wR2wR3wR4wR5wR6wR7wR8wR9wR10wR11wR12wR13wR14wR15WR0WR1WR2WR3WR4WR5WR6WR7WR8WR9WR10WR11WR12WR13WR14WR15wcidwCIDWCIDwconwConWCONwcssfwCSSFWCSSFwcasfwCASFWCASFwcgr0wCGR0WCGR0wcgr1wCGR1WCGR1wcgr2wCGR2WCGR2wcgr3wCGR3WCGR3acc0ACC0Short branches, Undefined, SVC, LDM/STMMiscellaneous 16-bit instructionsADRLiteral loadsHi-register ADD, MOV, CMP, BX, BLX using pcHi-register ADD, MOV, CMP using pcThis coprocessor register access is deprecated in ARMv8pc_g0_ncpc_g0pc_g1_ncpc_g1pc_g2sb_g0_ncsb_g0sb_g1_ncsb_g1sb_g2reqdnqnunreqcodeforce_thumbthumb_functhumb_setltorgpoolsyntaxcpuobject_archarch_extensioninst.ninst.winstrel31fnstartfnendcantunwindpersonalityindexhandlerdatasavevsavemovsppadsetfpunwind_raweabi_attributeextendldoublepackedVFP system register expected0.01.02.03.04.05.00.510.0|D^D]p@<]4X]Y0la^la^la^la ^la,^xY\,>S\G8^XS@^RL^RT^RH>`^ Qh^l=VdEt^X^80^80^80(^@^D$8=8=0E^d<obj_elf_vtable_inheritadjust_stab_sectionsobj_elf_visibility;AH8KO;(===<<<?;;;k;X<;=TKexpected comma after name `%s' in .size directivemissing expression in .size directive.commentbss"data"bad .common segment %sexpected `%s' to have already been set for .vtable_inheritexpected comma after name in .vtable_inherit/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/config/obj-elf.c.noteexpected quoted string.size expression for %s does not evaluate to a constantinvalid attempt to declare external version name as default in symbol `%s'symbol `%s' can not be both weak and commonassuming all members of group `%s' are COMDAT.groupcan't create group: %sMissing symbol name in directiveexpected comma after name in .symvermissing version name in `%s' for symbol `%s'multiple versions [`%s'|`%s'] for symbol `%s'functionSTT_FUNCSTT_OBJECTtls_objectSTT_TLSnotypeSTT_NOTYPESTT_COMMONsymbol '%s' is already definedgnu_indirect_functionSTT_GNU_IFUNCsymbol type "%s" is supported only by GNU and FreeBSD targetsgnu_unique_objectsymbol type "%s" is supported only by GNU targetsunrecognized symbol type "%s"expected comma after name in .vtable_entry.popsection without corresponding .pushsection; ignored.previous without corresponding .section; ignoredprogbitsnobitsnoteinit_arrayfini_arraypreinit_arrayunrecognized section typesetting incorrect section type for %signoring incorrect section type for %s.interp.strtab.symtabsetting incorrect section attributes for %signoring changed section type for %signoring changed section attributes for %signoring changed section entity size for %s ,; missing nameunrecognized .section attribute: want a,e,w,x,M,S,G,Tinvalid merge entity sizeentity size for SHF_MERGE not specified? section flag ignored with G presentcomdatgroup name for SHF_GROUP not specifiedcharacter following name is not '#'writeallocexecinstrexcludetlsunrecognized section attributeidentlocalprevioussection.ssectsect.spushsectionpopsectionweakinternalhiddenprotectedsymversubsectionvtable_entry2byte4byte8bytelocloc_mark_labelstls_common????gen_to_wordscannot create floating-point number/srv/home/pokybuild/yocto-autobuilder-new/yocto-slave/nightly-arm/build/build/tmp/work/armv5te-poky-linux-gnueabi/binutils/2.23.2-r4/binutils-2.23.2/gas/config/atof-ieee.c%s: error: too many @-files encountered out of memory D[x Phlo$u X  thohooDohoxoot(V!HFqHFF D!H0F<H.HPFHa!H|!H<HHsF@k!H|F$F"HHHH@!H,h!HF$FD H,!FFA!H(F>!HsF4!HF{FFGHhi!HhFqFsFX"FhyF܃FLHH(F,F̏F\D!HH\FFXFFlFH`%F HFpH"Hy"HFF HHHH!HB!H-HH,"FH܍Fi!HE!H<Fd!H\L!HH,FF.H6$HH0F@ FwF${FHF HFFLH4FFxyH|.HDHpHxyF :&HH>&HHX!F4!FHHK!HثH%FPFwFAFdv ( 8 ^ <d @PQ @PQ@PQ@PQ@PQQ=Q>BEHQ?Q@CFIQADGJQKQLPSVQMQNQTWQORUX4S8S >@>@,>)0>)4>,<>,D>*H>*L>T>\>d>l>t>|>/>/>1>1>0>0>5>5>6>6>.>.>7>7>8?8 ?:?:d } x  {   |   } } (4} Xh} x} Xy Xy   8$L`$(0\dtHX @,~ CBBBBQ00000000000000000000000000000000-H -Hcccccccccccccccccccccccccccccccccccccccccccccccc ccccccc cccccccccccccccccccccccccc ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc@-H  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8nF(F@nFHF0nFhFHHnFXF  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~libopcodes-2.23.2.so_ITM_deregisterTMCloneTable__gmon_start___Jv_RegisterClasses_ITM_registerTMCloneTable_sch_istable_sch_tolower_sch_toupper_finilibbfd-2.23.2.sobfd_initxmalloc_set_program_namebfd_set_section_sizebfd_reloc_name_lookupbfd_make_section_anywaybfd_is_local_label_hex_valuestd_sectionbfd_get_arch_sizexstrdupbfd_hash_set_default_sizefilename_ncmpxexitlbasenamexmallocxstrerrorbfd_get_reloc_code_namebfd_scan_vmagetpwdbfd_get_errorbfd_set_section_flagsunlink_if_ordinarybfd_elf_add_obj_attr_int_stringbfd_make_sectionbfd_set_relocxcallocbfd_map_over_sectionsbfd_install_relocationbfd_elf_add_obj_attr_intbfd_set_section_contentsfilename_cmpbfd_elf_get_default_section_typebfd_get_reloc_sizehex_initbfd_errmsgbfd_elf_add_obj_attr_stringbfd_arch_bits_per_addressbfd_reloc_type_lookupbfd_set_formatbfd_elf_obj_attr_sizebfd_allocbfd_get_section_by_name_ifbfd_set_error_program_nameconcat_bfd_elf_obj_attrs_arg_typebfd_closebfd_is_arm_special_symbol_namebfd_cache_close_allbfd_make_section_old_way_bfd_abortbfd_get_section_by_namexreallocbfd_set_symtabbfd_openwbfd_elf_set_obj_attr_contents_xexit_cleanuplibz.so.1deflatedeflateInit_deflateEndlibc.so.6fflushstrcpy_IO_putcsetlocalestrncmpoptind__strdupdcgettextftellstrncpymbstowcsstdinstrftimesbrkstrtolfeoffgetcfgetsstrlenungetcmemsetstrstr__errno_locationfseekvsnprintfstdoutfputcgetrusagefputsmemcpyfclosestrtoulstrcasecmpraiseasprintfoptargstderr_obstack_newchunkstrncasecmpfwritefreadlocaltimestrchrobstack_freememmovefopen64_obstack_beginbindtextdomain_IO_getcstrcmp__libc_start_mainferrorstpcpyvfprintfgetopt_long_only__environ_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.4libdl.so.2/lib/ld-linux.so.3A*aeabi 5TE arm-poky-linux-gnueabi-asleELF(4 4 (p\\`\`444444hhhhhl tttHHHDDQtd 44HH !hh$4o> 88 FHHNoDD"[ohh j hs  | wHH#PP XX p\`\ d`dhhllpptttt\\x p+ .shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink.dynbss.gnu.liblist.gnu.conflict.gnu.prelink_undo TThh !$4o> XX ohhx NoDD"[ohh j hs  | wHH#PP XX p\`\d`dhhllpptttt\\x L$$4F$u $p=+h #l5