ELF(4H4 (p'444444''''' H&$)$)$)HHH Qtd/lib/ld-linux.so.3GNUF @PP` A@b9%`A 0A@ 0@8 hD DT @@"@$@@ "!`U ah A"DV)  @  X@Ib`FF@@@ <@ @ 5j E BPH L@  DCH@ UH @ @ (D(0 5ƀPi0uQ( `a! <  a$`$0h@4C @T 1h#MF@ 35 @чDPD  @  "#$&')+,-./1456789:;<=>@ADEGHIJKMNOPQRSTUVWXYZ[\]^_`abcdefghijlmnoqrsuvwxyz{|~      #%'(*+,-./02345689;<=>?@ACDEFGHIJLMNPQSTUVWXYZ[\]^`acdfghijklmnoprstvwyz{|}~`zRu#sk|nG~b.z|]2[<1 7G*X;"S,`|);B =#m\5c$iȯM$O_RlAUvNf)=I0 -Wj CqX?l0út3zmRwz"S')~>a>QZP8.Sr~-2@ڡ1C /u8΁Y<ѨPe^"uХ]p7XI>x7? OudP ].$­KU0,XωDy }yI8(T_I! R Y$O! 5 B0EŌ.<'ɹ;zwB M…xk 7.u.N=/1׫TP%^gϙ+dUnc%c+d3ˡwq9H03CEς9AU<9@ 0/#s@1H`G;y/FS+&z t/t_qo{m] >B1/t:=|i >eW4蹍|s'ME[ȇ#)mU0M| < %_NI@f Io:fIXGWۓSMF%.$[;3 [r\_|NULs[[0QIk0Kuw}4S,?oB@j$C6˖a? X5%d;S ]v5 Iw=edޓ)ޓޓ -lUAApGDZ=y.K ,APn#%u 0MF0D MMU޿BhnENGu>!*! GIiGx kTIAw;@$2h tmDd`~"?~|ڱ1Sf!'6{S30 mj4#v5zEdY㙔|Eۚ](ҝG0bu᚜*" $m ה)sIf"ua;Jm'gII"`;3bARu;Ҁ8p DfZwS6D'e 6Mw6vaOb8u^Yywi0p& qLF  F4 [Լ PH 4` X $ Gܹ0 #l }  G , L< /} FHuZ \4t s| W0H/[,"d B 0 8 ;t.n " F @- W G @ 8-+ .L hH H@  q 0|o    | { t K x< 0 c/d4 $ ' t( T *G',{ %` \ \TMN t  zx l  `P xH!Lx   | `8  = 3$  `, Pnx G=$ qX  M Mv   lX H;0 1 R >0 Mx@x w M8 `| $H?( h/ @ `p * A@ S-LG(T3 MT @ ` MJ \ } ;Gp W  @ ` D,$ 0  b  8 ]   4   [ L P t   $ t  |H0$ < X ( t K4 0 0 Zhz.< <.,| | ^KM$ 0$ hXH=Nh   T  tX [ 5 x8 / x$   d d / h hx$ HD &l @ b H =t 0T\    D  W\ Gp)0  P  | | 60o kM0| ll @ d6D Gx-G \-_Ľ i +  @b4 .M3" ( "k 1D/1x X$/ mp  $0$ z + $d    \  d8h/&  T  cx  %4 GBP$8| 8\ 3 rM|P@ Xz0 (@  6| ` < Q :` x + @ n8  M} (| 34 s a| L<  u l|H g +G Md } g\ p DL $ h Y4 @ MM eM    Dd ,t3mG G( 8MS  / -Ы p, m  N ( `h | q| ||  @ ] $-p8 =. k /K   Pt MMXbC U( | { T% M  Mp N t=< { (,  .@  Z tg8 |M$H/  $ B$wl0N|T fLBT libresolv.so.2__gmon_start___Jv_RegisterClasseslibm.so.6ceillogpowlibdl.so.2dlsymdlerrordlclosedlopenlibc.so.6socketfflushstrcpyexitsprintffopenstrncmpoptind__strdupperrorgetprotobynumberftellinet_ntopstrncpyputcharabortstdininet_ptonstrtodstrtokstrtolisattyfgetscallocstrlenmemsetstrstr__errno_locationbindmemcmpasctimestdoutgethostbyaddrfputcrecvfputsmemcpyfclosesetsockoptmallocstrcatstrcasecmpraisegetenv__ctype_b_locsscanfoptargstderrfscanfgetopt_longfreopenif_nametoindexsendmsgstrtoullfilenosethostent__getdelimfwritefreadgettimeofdaylocaltimestrchrgetsockname__ctype_toupper_loc__ctype_tolower_locgetprotobynamestrcmprecvmsgstrerror__libc_start_mainstpcpyvfprintfsnprintfsysconfematch_set_inparse_offsetget_s8tc_qdisc_listtc_qdisc_modifyaddattr_nestfw_filter_utilingress_qdisc_utilprint_gactll_remember_indextc_calc_rtableaddraw_lparse_rtattrroute_filter_util__get_user_hzpedit_print_xstatsp_pedit_tcptc_align_to_atmparse_atematch_get_debug__libc_csu_finihtb_qdisc_utilget_linklayerematch_allochexstring_a2nematch_inlib_dirhtb2_qdisc_utilget_qdisc_handleformat_hosttc_cbq_calc_maxidlebatch_cget_tc_classidll_proto_n2aget_tc_libincomplete_commandtc_print_one_actionrtnl_rtrealm_n2aprint_classfilter_ifindexgact_action_utilprint_size_tablell_init_map__iproute2_user_hz_internalrta_addattr_lll_index_to_addrmirred_n2ado_tcmonitorematch__scan_bytesparse_actionematch_restartprio_qdisc_utiltcindex_filter_utilbfifo_qdisc_utilematch__switch_to_buffershow_statsget_rate_and_cellnat_action_utilget_jiffiestc_action_gdsprint_linklayernbyte_ematch_utildo_actionrtnl_rtscope_a2ngetcmdlinepfifo_qdisc_utilparse_valaddr_to_dottedematch_rootparse_egresstc_print_policeget_pedit_kindhexstring_n2ado_filterget_unsigned__get_hzematch_lloctc_action_modifymeta_tableparse_peditstring_to_number_lpolice_action_n2acbq_qdisc_utilematch_linenoematch_pop_buffer_stateget_qdisc_kindaddattr_nest_compat_endematch_debugparse_mungetc_core_time2ktimehfsc_qdisc_utilematch_lvalematch_errtc_act_list_or_flushget_prefix_1skbedit_action_utilget_percentematch_set_linenortnl_rtprot_a2ntc_adjust_sizertnl_send_checkematch__scan_stringsprint_sizertnl_dump_filter_lrta_addattr32sprint_u32_handletc_setup_estimatortc_print_actionaddattr_nest_compattc_core_initematch__scan_bufferprint_timestampematch__flush_buffer_IO_stdin_usedematch_push_buffer_statepolice_action_utilrtnl_rtrealm_a2ncmp_ematch_utildupargforcemultiq_print_optflow_filter_utilematch_lexsprint_percentparse_mirred__data_startnetem_qdisc_utilget_filter_kindematch_lex_destroytc_class_listxtables_register_targettc_core_tick2time__aeabi_d2ulzparse_gact__bss_start__ematch_parseget_action_kindsprint_ticksem_parse_errorget_u8ematch_argcdotted_to_addrtc_red_eval_idle_dampingtc_class_modifytc_calc_xmitsizeprint_mirredrtnl_open_byprotoinvargresolve_hoststc_calc_size_tableaddattr_nest_endget_integerget_size_and_cellematch__delete_bufferget_u16do_qdiscshow_raw__exidx_endipx_ntopuse_iectc_core_time2bigtc_calc_xmittimersvp6_filter_utilinet_addr_matchematch_get_linenoduparg2get_s16act_usageprint_tmmirred_action_utilget_actematch_charmultiq_qdisc_utilstring_to_numberget_police_resultsprint_ratecmdlinenodnet_ptonmakeargsrsvp_filter_utilaccept_tcmsgpfifo_fast_qdisc_util__end__missarg__libc_csu_initbstr_print__bss_end__sprint_tc_classidget_addr32pack_key8sprint_qdisc_handleexit_errorsfq_qdisc_utilrtnl_dump_requestematch_reallocinet_proto_n2astring_to_number_llematch_get_textematch_get_inpfifo_head_drop_qdisc_utilbuild_stll_name_to_indexematch_freeprint_filterematch_lengrr_print_optematch__flex_debugematch__create_bufferrtnl_wilddump_requestprint_tcstats_attrematch_nerrsdsmark_qdisc_utilematch_errorematch_set_debugparse_rtattr_byindexget_addr_1mask2bitsematch_textget_rateprint_peditmatchesget_addr_and_pipedit_action_utilgact_ldematch_get_leng__bss_startget_u64basic_filter_utilipt_action_utilcgroup_filter_utilexit_tryhelpinet_proto_a2nprint_qdiscematch_set_outrtnl_dump_filterparse_size_tabletc_core_time2ticktc_filter_listtc_red_eval_Pematch_outrtnl_dsfield_n2ashow_detailsrtnl_rttable_n2aematch_get_outfilter_classidget_sizeget_timeprint_ematchpack_key32rtnl_rtprot_n2aematch_argvll_index_to_flagsshow_prettyget_addrprint_ematch_treeparse_ematchgred_qdisc_utilrtnl_closetc_cbq_calc_offtimepack_key16rthget_u32parse_estimatoru32_filter_utiltab_flushrtnl_openrtnl_listenprint_tcstats2_attrparse_cmdtbf_qdisc_utilpolice_action_a2nu32_ematch_util__iproute2_hz_internaldrr_qdisc_utilrtnl_rtscope_n2aact_parse_policebstrtoulrtnl_talktc_core_ktime2timep_pedit_udppack_keyrt_addr_n2artnl_from_file_edatapedit_debugmeta_ematch_utilget_u32_handlell_idx_n2ap_pedit_ip6ll_index_to_typertnl_send__exidx_startrtnl_rttable_a2nrtnl_dsfield_a2nsprint_timecheck_size_table_optsll_proto_a2nget_prefixtc_red_eval_ewmaprio_print_optdo_class__parse_rtattr_nested_compattc_filter_modifynew_cmdbstr_allocp_pedit_icmpll_index_to_namednet_ntopfilter_qdiscp_pedit_ipf_protorcvbufGLIBC_2.4J ii 3 ii rii +Q++P+q+zGz+IGI++xGG*GV0*4*8*<<* @*D*\H*FL*gP*T*X*s\*`*Zd*h*Ul* p*t*x*|*F**@**)*E*****9***?**6****t*=**1*****O****A* ++o+ +++>++P +#$+J(+I,+0+4+$8+y<+@+D+H+L+UP+T+NX+\+,`+d+h+l+cp+t+x+|+++@--p\Ə5ʌpƏ5ʌhƏ5ʌ`Ə5ʌXƏ5ʌPƏ5ʌHƏ5ʌ@Ə5ʌ8Ə5ʌ0Ə5ʌ(Ə5ʌ Ə5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌxƏ5ʌpƏ5ʌhƏ5ʌ`Ə5ʌXƏ5ʌPƏ5ʌHƏ5ʌ@Ə5ʌ8Ə5ʌ0Ə5ʌ(Ə5ʌ Ə5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌxƏ5ʌpƏ5ʌhƏ5ʌ`Ə5ʌXƏ5ʌPƏ5ʌHƏ5ʌ@Ə5ʌ8Ə5ʌ0Ə5ʌ(Ə5ʌ Ə5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌƏ5ʌ  --- 0H 00S/Xh0 R  /G$@-0S 0S/@/'R@- \ S, @s @0LlR@- R 8 B@_Q@-0T@ @0O70@@ 0 @0, @0' @0- @ 00. @`0 @h0< @0: @/ 0@@-P KM@0$ Br R$0SJgp`@ R R Kߍ    T}!R 0%S X0@ 0Si r} R[ R @A@@P@ !R@ Pj 03/ 70@0S !R 8@㥋 70@0S 0$1 1S5 8! @I?d tT $!R 0S 3/ f70@@ 0E ? x @Dwh@ <1S1SL @0%!up 0@| 0@$@@ H740@@ 0>E-MMOȍOO__O` $ p @0p//O0<0@0D0H0L0P0T07h0l0p0t0X0\0`0d0$0q0a@0eS#0vS 0S@D`T`@ ȍh0Sh 88@D0`@`Tz( `p0dS @P00S@DT0O0@ x< P(x0@`00@P40S 040@P  H@P@DT`O`@T 40Sx& P{ȍ( x0@`40d@P p@o0oOP ȍ@0~P@`|@ȍX0SY}0S,T5 \ /O/O0 @`0 @0$ @@: 0@@-P KM@0( Br R$0SJmp`@ R - @ R R Kߍ ""(- @ R    y1S 0)S  00R 0 Sr f!8 0@ i=0@0SR ro 0 Sr Qx@ V RI!R@ PF 0SC 3/ N70@0S 0$1 1S; 8! @I?+ ;T $!R? 0S R!3/ +70@@ 0 vrh@  H@"(T 0@1SL 0@up 0@1S$@@ B7 0@@ 08E-AM,M_OA͍(_OOO`p$ `0p]/A /O(V0$6P0T0X0\0@0D0H0L0rᰂQp!0eS"0vS0S`FA-( Vp`p? ʍP0S<A  `FA=(0Vp`p+0dS t @PP`FA(V㨯pOp` 40S#A  (PA*(`0`p`F40A=V(0p`p@ʍ@0Se0StT| \ /AO(/O0 P0dS |@>P@T 0PS @P @vyt@(P@T 0PS @P |@`y@P%0S]@D0T0| @q0S2| *@ 0+rP;7@0@| @ @0@ sP20ЍH@P 0SU@TB ,`PJ,00@MyP+pP =0@70@@ `@%7|0@@ 0o70@@% 0e7D0@@ ex@x|@xt@xP@xH@xp@-PP@8ڐ@xP! @xP' @xP @xP$ @xP @xPEp@( E0p@H( E0p@B( E0p@=p@) E0p@4@xP @xPPp7h0@@ p@-G@@D 0@0$ @0, @ 06 @@ 0. @ p 0? @`0 @ 02 @ 08 @ @< 0@@-@ [MP0, Br Rw$0SJQ$ D`HLPTX\`d*uH1S 0-St X P@0@ {0S S Boh@ w0S  S rl ax @fpW 0w'xS@PP0S6WEH!@ PH,L!R PQ 0 8!Q @0, <[ߍ7` 0@@ 0W W S P L 0@@ A@ l~@ p 0@`1S  0@$@@ 7p 0@@ 0O-M|M@  Ox  xOP$  09 $lcɍ $ $ⴧX\`dHLPTU? ?Ox,T $B"   Ox`Vuڠ? @?O@P!0eS"0vS0S`F)x VP`Pi ɍX0Sf X `F xVP`P0dS  @PA@0S xx0P`@0`FPV``H0Sl0DV / ? /Ox?O$ 0 H9 9$H0$ r 9$t0$ r X0S ~70@@% 0H7 0@@' 0>ɍdx@0uP) t / P x`P@`7 0@@- 0u@ux0@u`P= ) x H0  Hɍx? ?O     B `x@0xuH@u@ux 0@iu @uux@0^uX @huE-@P0A@P?@-@ ?@-M@/  A 0Ѝ J 0S+`2 Q0 A{z%S0S Y@A* -g M@. @a ЍY@A@-@ ?"8x- @@-@ ?0@-@P `p8xN@@/ @lHN@@TN@@dN@@\N@@pN@@0@-@H M@PpP00 Ѝ0\@pP0@pP T@p0P 0oS d@pP0 0@ P0 0kS0S 8@-@P@pP008@pP008@pP 8R :R d/> @0@d/> @0@d/> @0@d/> @0@@-@ ?A-}p@`@PU& 00 0 ?]}@ A ?T}@ 0 ?H}@ qPpC-P0M@`d 0C mhQ x0x0 B|0R #00:؇0@ 0^pQ P0P0 BT0R #X0\0`0"\@X `0GlQ 00 B0R #? 4@ 0/pQ P0P0 BT0R #X0\0`0l0S ?T \L@ P0Ut00ЍpH@ M-\MP`@ yT 0SR Ѝ QM XX B\(R( #`dhlptx|`0hإ@ 0d0 0h00lpW2 H @0 @ ?A @ppW5tX8xpW  0@?  @X-0TS0ppW t0Sx0S H@ H @ 0@{@ xp@ 0nW@ p 0p@-,@CM`t@PT(@Ct@T$@Ct@T2S0S 1S  Cr R (@LЍp  \0@-PP,M@4UJ PEU@\@nP @nP7d0@@ 0WP @P+ 70@@ =j,Ѝ07x0@@ ?gPNf70@@ tiPpf+lf'Nn$@70@ @0@-@Pd%t%%%<%pN@@/ @HN@@TN@@dN@@\N@@Rp@-XM@` 0@ 0CAkDPUm 00C7Sq` @ f(@  v @  @ 70@0S0(P5P0S A4@ o @ @@ fT0S& @ L@ ZT!@Ud, @00OXЍp@ G(P $@ = E@ 0)@ 0!0@-@H M@PmP00 Ѝ0\@mP0@mP T@m0P 0oS d@mP0 p@mP0 0@ P0 0kS0S @-`p/Pd@P00P T/00PT/00O-MM`pP;@ P㘈h(d(`(\(X(&TPL(( ($(((,(0(4(8(<(@(D(H(n @TPn @Tj  kPm@TPx @8mP P@2mP* x@ P#  @P 0m0S* tR' uR$ R!@T8 \8S,!  ,P @p;@T& `8S Px@`+ @ 0v 0P S0pS0uS0S@T X8S&P  @=70@@ 0tЍۍZ 08S `(R <(R,S{\8$8 0h>0 8h08 S<8Svh8Snd8Sf0000iຐ@PS \8S ˍB NP(Tȝ8uP0`t<(\8R$8  ˍL(Tȝ uP70@@- 0 @P:  @PM@Tk h8SP @p70@@ 0vf h h 0ˠ%hB 0Nˠht@T6 08SP @q<70@@ 0B2 @kP@T <8S΍(cP @P70@@Tڐkd@kP08 \@kP40870@@% 0780@@ 070@@ 07X0@@/ 070@@ 0@kP H@kP08I T@kPB p@kP08: <@ P D @P@T  P# 7T0@@ 0( @VkP#@Tu  6iP ( @|7$0@@ 0r\870@@ 0vfX @,kP @TK |P X @S@PPGh@@E @0SC 0@M2 0@G(< 0@AhD 0@;? 0@5@+ 0/r@-M@0 0hЍ0  @m@-G@@) 0@ 0, @ <0( @h@ 0@E-Pp M@pG`WC0SE@jP" P>pW2 @`jP P' tP70@0Sp` Ѝ70@@ 070@@. 0jd@@6jd@Bjd@@-jR@- R  B@@-0S7`0@ @(@ @0@-G@@x 0@s@!0mA-XP@BM@`pW pW PBߍL( @@0zpP X(0 @opP,Vh@ `pWPp 4pP 0p0 @&5 @0@ 00p0@-@@iP@iP @iP@ip3O-4Mp0S ,0({ 0 h Pe,@`@Z(<@@@ @$@ P!0J,S(PhP@M,ZUT 00   c ,0  0(004Ѝ @P6 P5(0 ,0S,#PPF  0@GeV 0>ep,( 0t>< Q00@-P,P @ @1\ M@@8!@h @ 0t 0@) Ѝ0@=x0@P@0 p@-S`PpG@@ @ p@@-080@O-}p@M$M0S @@= 0@0 $l(  Z`@P P P P0F00`@ 0Ξ04@ H8@@<0,0P0[=: 7\ 7R ! P j ɐ l < !00000` "@\0Z 20 IR㉰ B L0 [* <0@0SU 0؁ x $0pR PX1P00ЕS(_(X0X! 0\& 0100c1PD00 220"S"0L Sg|gpgTgpcgfffHg` Z 20" 020SL P,!@1L  L{L0S= 0c$"V2PXLP,pT@\8@ b @- fZ @ pPT\X$0Ѝ@\\-@( @:00( P0 0Pm PD0]P@S <40IKBD PHD@ό\ 1X P_P\0S$P0$ S(0 , @(0,0/@ @,-( @,  &70@ @0, @ 00T4 $40 00H~^*0 P80P 0g000 P0H080XH0 XX1L0@0S},0D @ @<0, 0 4 IK BDP,  0RP u0K$8 8|P PPDP/  0,D) PP  0DP0  D D0 D0  D - @ P0 b0c`fc= 0@ |\0QAS@ (@@P P$\QuPX, @0, @ @ P@  00T 8`@` P0,0 @ @,P-( @ ` 0P P0 b0c`f`0P>-=<0@@p W)*H@ `0 S0;0S*P  QQ>E. @@@W> 00SpfN W@: /<80@@     /@- 00`0;0S p*P 0Q>`` E.q` W> 00Sfn p0 Q`[V` 0; p0S0 `0 a; 0 `SDq oqqr4r\rrrrrrrrsspsxsssssssdqdq 080R 0<8R0@' @  <8< 0@R' @ < <8 0@R 01S IHA-= @0@@@ 0g,Ѝ@ @gg 00 ` (0S  0,000Y00(P p,@9- @0PP@0 p@$ d$Pp(:70 0@@& 0 $ X@M$P7\ 0@@0 0l      0,`$0 Sp,`$0V*(0 ,A{yw =0@  o "=0@ R c 0 p<0 0 0 0001, Rp,   0S!  S @ 1! ( R p 00cS  0!```)  P@2 p pBp`W00S0,P   > 00C0g0SQ00S `0 g @U0 0 1 00C0gS0=0@ Rڴ@P pPl BR 00 0!00SWn 0 01, 00 S1 0ܭ@P1 *  Rg <@ 0 R ţ1 0 lPe 010S @0 p0C4 ?0 00  R*0R7 0@ @0  |! !    @0  A\ <( @```! 0;0S<80@ `00QEW SfΌ*P 000 pPpp b7 0@@* 0 <$050P(8@-PP8 0@E-@QMMP`{$:p'D?CF,q(q $qq qqq @T# BLP@DTuPT@P mZ P@ P9@T KTP 7| 0@@0iS0nS0S@T CP 7\ 0@@ 0aS0xS0S@T P 7l 0@@@P @T JP 7 0@@@P`@T @F/HP 7 0@@ 0hK$1Sv Pz 1Sw ,Qt 1Sq (!Rn _@P TsF  A_P0($!_PW@1 010P@Q B?Q 0̠Q PP 0  0c0Mߍ@VP@TO I@P+ 7 0@@ 07\ 0@@ 0eZ! @3P&I@ P70@@> 07l0@@,!0cS0nS0Sp7p0@@ ,U70@@& 070@@- 07@0@@( 07 0@@: 0Q@O-@P$M`p XO@T  RPI@DTPH@ P d @PXH@DT  0QW@2 Q$Ѝ @Pp  @P8 X/   RP30 R9:ZA  0B7P0@@ 0*  0P7l0@@ 07p0@@ l70@@ 070@@" 070@@  0Q@RTRp@-M@Ѝp0 0CS0PPQ`P@ 0x@ `VP @20@/\ @@ 70@ @RA--@MЍ0 0C=Q`V00C#SPHwp@c(@ \0S f{E kH 0`c$ @0wg`@0SgP50S H\@ dzjguf  r\0S g `8P{H h@ L R p@EkH @ :H$@ 2 Q1S o\0S f{/ kHp g 0sa8 @00S @ @ : zf g  \ f `9HIΟkH 8L@  .A@-G@@|O 0@02 @@& 0@G-M@Q;H径0D@<8408  $(,pP`T@dSPU_ $8<(SRPZpPE`X{ P? HQ< (R D8S  $8SD8<8Sp : RfD8g++b{f+"{7 *D8f+:af qG `{Nk*$(ˍ  8(0ȝ[P%H[ 8S( ˍ 4(D80ȝ[P8 Ds[, 0 PN; 0$N; 0 k`N 8PPSp0000pgpaH@RPU $8<(SRU Pd H@FHP@RP x@ /PU H8Su!  PDx@&( @P mY-0tS*0uS'0S$U D8S!  P @T @ލ7(0@@ 0.A @P Y30pS00uS-0S*UI @8S! P  @ 0`U 8SQfP @z|70@@% 0$r@@_P 7p0@@ 3a70@@70@@* 0R70@@( @QP!U 4S!  OPQ ( @247$0@@ 0*7P0@@X @QPU P/ X @70@@ 070@@ 0 @-G@@D 0@40: @p0= @0; @04 @$08 @`@5 0@@-G@@7 0@v@+ 0@o70@ @qR-MЍ00CS z@ 0   WE-FM M`@Q;pvP0`t\XtTtPtL44t8t 0 L0 ˠL70@0S p@ W F> 0` c KX B> 0 KWw A> 0 KnTĝ$X<\4Y$2 $HPĝ$X<Y$& $ ;,<@OP $4 $04D@OP1 $4 $047x0@@3 0;7$0@@% 014@T,,O@L$7L0@@) 0L@hOP  $4 $04@0X@VOP $4 $04p`@IOP@T E LP0\4S#404Z@3OP-@T  P H$0 RG  Z70@@ 0]7h0@@ 0S`@@@N P @T~  LP"H4S)4@NP@Tj B΍P @70@@ !@{@NP @TH ApP4 04 @NP@T6 F_P  @W @zR@NP@T CHP@NP@T A Pp@V.70@@ 0$@rNP@T A @B.0PP0$4( @\NP@T F NP @T   PW X @@+NP 7p0@@ oRA-PM] 0 0CJpW 00C Sp@T 00CS@s`V 00C S`uX 00C Sw0S  BRzW @ ( @/70@0ST 0SV  R @70@0S!T 70@0SXX 70@0SЍ@  @ R @ @ R @i @ R @70@ @0@7(0@ @0`7@0@ @0}X@@0|0 @0Sh0s H3@ 70@0Sp P H@ 70@0S{ @ u(0 3 RWL@ 0m 0@gI70@ @0p]  0@VA0 #@W R$ R& T@M!< 0@=0 H3@ :70@0S @ 0@+@ %,-G-MM@Q;@<840  $(Wp P` U B'PXpPE`E@LP @LP `@L PU CIP04S7h0@@ 0~@~LPU B $P,4 S  Y70@@ 0_(4S <4S ˍ 84B R8$0 4ĝ UP04<S(0s0044T& < 0 PPP`6H B> /H; 0'H 0 ˠ H70@0S p?@@W 0000`f`HЍۍ @@KP U6 C P= @ @KP U"  P*  @@KP,U CvP @`@kK7T0@@ 0@7,0@@& 0( @KPU   |IP ( @b7$0@@% 0~X @~KP U CP X @Dj@jKP 7p0@@ $Z70@@9 0tQ@O-@P$M`p XO@T  HPI@DTPH@ P d @PXR@DT  0GW@< G$Ѝ @P-  @Pp X   HP30 RB:Z7  0B7P0@@ 0+7p0@@ +~  0F7l0@@ 070@@ 070@@ 70@@" 0  0G@SJRp@-M@Ѝp0 0CS0PPG`P@ 0x@ `VP @20@/\ @@ @-0R  BR @070@@ 0Q@-M@@PЍ7p0@@  0AF70@@_/0u70@ @w@-P`tM@`VJD ?V1 \ 0F`pWh`VlPU@H WDP%LPTTP=V P`U PmP RtЍ@:@H 3DPPp @ 'XP {@ W P t@ @  W P t@ @ W P {t@ s@ P it@ a@ P Wt@ 00CS`^00CSP\v00C SpN7 0@@ 0f0@- M@wP0  Ѝ0QPPQ070@@ 0@-M@ 0 A@ TЍO-PQM`@?`````0````````````T@IpPPU @Pw@PEUT@HP H@HP?PU PU0@S_0S Vb 0S 0S\7 0@8 @0G@P mPPEU P 000UPPE@0@HP 8@HPFPU ?PU @]P 000/P 8 @\T @WЍ0SK 0S00  0}DPO0SC0S0SVq 00   c \@]HP @@WHP6PUf 00PU^ @P@ 000P @ @7 0@6 @0s  0 -DPH@H@HP,PU) 00PU! @P 000PG H @qp  0ppCPGP@G P-PU E@P P @O7 0@* @0D  0CPW9  0CPI.T@GPPU HP U @fP ;P T @h`@GP9PU kpp`jp* @0@``PE  0p@5 @0 S#S 0G 0  0 0T Wʲp@@@P} 7p0@@ 70@@ @p8 53 W @-7@0@p|@ 0 o@-G@@` ; 0@X 0+ @R0; @L 0: @F 0> @@D 07 @:| 0& @4 0 @. @/ 0@'@-\M@Q ~> ~ 0,? @3?@\ (|$ 0 -? @3?>0Ѝ?^0!?3? @#8!~0,? @3? ~0 -? @3? 0!? @3?@-P<M@p@P ``Wc 0 0CaCT]@Tb R T 0S{P@ 0Sd  0@ 0P T 0Sx T Pg R_Q2  0@~ 0Pz t@ zT 0S\ ~Q BЍD @d@T 00CS@T 0S !@ MT 0S   0@8\@ ; @ 1@,@ L@ # @  @ TW  RT p@O  0@  0@UO-PM/@` r@Q Pp  {CP Ѝ@0Sn1/ 8(#<"40000 D CPWI/000p0S0Y0S5@ @P2 @P, @PF $@P@ ,@ PNY CpPD Q0Ip,3?/O: 0' 0 pY  pBP000  3?00S300Ip1 /O ,<40Y  pBPx0003?00S2000uS03Sd02S0S0 00uSW03SI02SQ0SN@? 0Yp  pBPG8@IYpP IY^  pBP5Ip0 aR tR  R IYH"BpP IpT T+  02/3?0 0i1S06S0S0@ 0 @1S 06SW0 0,<8SL0S H 0(8S S 0$4DG-@M<@ 0 `p t x |     $ ( , 0 4 8 < @ D P T BP PЍ@p0 @;@07S(0T@-DP, 00C 0S000H p0P rPgIP0 @t0S0S5 0@ST0000j00p@CP! 00C 0S000H p0=P<IP0 ?0S0S @ 00x@CP 0@CP( 0 B R  JP@ 0 0C 0  }7\0@@ 0g70@@ 0]0t@CPP% P@ P  @ P000 00C 0SaڌAP0@0 p0w?h00 00C 0SIpPi 0c?7@0@@ @ٿP200 00C 0S* @PN 0C? PI YPP @㷿PIPYP  @P20@0eB$ @CP; 00C 0S000 0!P1 7,0@@_70@@ 0@70@@70@@K70@@ 0,70@@ 0"0@@\P 7p0@@ -@P P``PPpWpW`BRp0! /PpPbPr"0@ "QR3*(12/0/QR@-@, T( T$12/0/0@-P M d0@@X P@2/3?U@@媾 Ѝ0@-G@@H 0@㖾0= @㐾 04 @㊾D0! @ㄾh0 @~ 㐾0% @u0c @o0 @i0@/ 0@b0p@-@MS8XXXXXXX XXXXXXXXX`0@3?s #8Hލp03?sE s /S @2/r 7 m? PP`p`@ V@ <` `~@ P003?S @2/"(03?S S @2/", @2/"( @2/"(0p@-@MS0000000000x000x00080@3?s #8ҽލp03?sE s /S @2/r > PP`p`@ V@ <` `@ P0ᦽ03?S @2/"(᛽03?S S @2/",Ꮍ @2/"(ᇽ @2/"(ွ@-@ M`:P:  A0SP :R R Ѝ U*pWpZP@ %0Sp :R RWPv @ 0S  P*v@ 㜼P >0SA-@P`% $::p?ZT6%Z  S.U70@0S! @0/x- @?#:'?`pl- @?t-0 @70@0S`p X) @ `pRO-MP@ 0T  0Cn=Th@Td0S 8@ ɼX0S T b`@ e "`@ @`\@ 0᲼`0S @ ᧼xX 00CST wp@0XS|0S  B Rf+ 0@ぼTD 0S9 8@Xw@@`p@@ 0S'0`S <#8"4 R0 @@!R00103/0S00 S !@O0S0va Rgl0S  Ilt R |@ 2pQ +Ѝ @0 $@ *"*R> ,@h@T: 00CS@3\0SR  H@R6"*X0S1TC 0@ l 0@9` @`LX @0ջ R `0@2/ջl0S,0@ »0  R0{ L@㽻0 <0@"$.(᰻| 0@㠻@ 0ᙻtG-Pp@W`]P X@ P0`0 X@6?PpW `00  <PpGp>p@- M`P 0@ 0R 0 Ѝp <P0 00C0<P0 0C0S aPtP R 0CS0  00P0 0 C0000>0@-@MPQ 0sP dPsPtP 0S A0rPcP Ѝ00SA  0000p@- M`P 0@ 0R 0 Ѝp [<P0 00C0O<P0S0  0C0PSaPtPQ 0C S 0  00P0 0 0000=p@-@` HMQP 00D@ <0HЍp =PD0@ 0CD0S@ aP !<Rr0  0c# 02/PPD00@00tP R0CS@D0 D@ <0P=G-` HMQp 00D@ <0HЍ <PD0@ 0CD0S@ aPtP R 0CS@D00 D@ <0vPQU e@0U U @ UD00@002H  ,1<P2H(2/ N=A-` 0MRp00, ($0BP @0 ! 嚹P4,0( 0C,0S( aPtP R 0CS(,0& ,( $0 P@0$ 0P@T,00(000Ѝ70@@(0 厹<p@-@` MQ0P00  Ѝp  :P0 00C0:P0 0C0S aPtP R 0CS0  0P  102/(0000<O-` 04MRP@, (0@<P,00C,0S(00(0b,( ,(pp4Ѝ(0@<P,00C,0S(00(0G,( 0,(p(0@<P,00C,0S(00(0/,( 0,(p(0@<P7,0( 0C,0Sp(pS$0pj  sRS dRg sR @x<Pj p0iS0hS0lS\$00C$0S$ 0$p(0D@S<Ph,(0H,Xp(pX$p 0sSE dS|0sSy0tSv0Ss0H 0pp. rR cR R00C 0 0ppHtR0oS0sS0S$00C$0S000$ 0]0rS50cS20S/0H 0pp(0H@;P.,00C,0S(00(0h,( ,(p tRS RP00C 0 0ppwf @D P:0HS$0MX(0L@;P (0P@;Pr,(pH,Y0 p((Y D @ 0PO0 I p  @P0H 0pp ; @P-$00C$0S$ 0, @ݷP0H pp @ηP0H *0pp@7;P$00C$0S000$ 0$ @㨷Pd0H (0ppp@ᕷPb @㏷PG 0dS0fS\  @}P!$0pp0C$0S}$ 0mS0fS\ $0pNp$;w$@UP&$0pp0C$0SU$ 0c /, @=P"0H (0pp N /,@(P$0pp0C$0S($ 068 @P0H )0pp$8@P,(p$0pp0C$0S$ 0 58P .8pP R0S*:",#<.,ă 0 p{PH$X @P0I  0(0`@,:P),(p`HX0,p(pXi  7 Pt7pPg`V 0  S5  0 p6 2(0@9P/,(pH,X0p(pXp7  0sS(0rS0cS0S0H  0pp8P70@@( 0(p,70@@(p,dS0sS0tS0S0H  0pp %70@@ 7h0@@ O-M M@( $ . 00ȍ0ȍvT TP$PЍۍ  0 嚷Ox5 @$PU 0$@i9P5$00C$0S 00 0($A( 0kPi$P@U\(00(08S  *"*R S008SeTY 00   c 0@,9P}$P `PE$PU` `tږw㔧㘇OOOPUk " 6P\+΍(0(0(0 PU` @9 P @8 PPUL " d6P=8΍0(0PU`0(0$P `t8@8PPU/  6P9(,#4("8. 0@@8 PePU " ,6P((0) 0(0G@@L@ 0) 0`@8PP$` p0F$0S `Fp@V@ "  a6P8T3?`F40p" 8@P8P @z8 PV@ " 5Pw8t΍T`F0p@P$P H@Z8Po(00(0H 0t@O8P P0 0$00C$0S" KPo"= 0 =4(00(0$P 0PE$P0 0 P@`᭴P |@!8 Pw$ 0A$Q i"m`5P8S  S C  04G$@@ @0370@@0 0$00C$0S" S5P=8S:  S8 C5$P 0PE$PU0 0]770@@ 0@7 P$ 0A$Q "  d5P] 70@@ P @` P0 0$00C$0S"m`FP8S :  0q350hS,0tS)0S&0 0$00C$0S" #P8S < R#:>(0:*0870@@ 0倳@㼳PO p@㶳P/ 0 0$00C$0Sڃ 2> 0 370@@ 0N7x0@@ 0D{<@6P]$00C$0S 00 0B$  0API$PsP <8Ȳ$0P P0C$0S)ڃ.$  0P%:8S PP |@K P $PL8H   B8#::68B7,0@@' 0&70@@ 07T0@@ 0$@6P"$00C$0S 00 0$  0P0$P007T0@@ 0廲7,0@@ 0@@P 7p0@@ 宲70@@ 0嚲70@@ 0吲70@@70@@LR0@-@MP9 0 0C3U40S P@ t0S D@ |;@ h0S D@ p;@ \0S -@ RQ #Ѝ0D@ E  ,@U$>@-G@@: 0@+0: @%| 0& @@0 @ @/ 0@G-PMQpP 0pL $(,048<@D  3P PPЍ 0 IOO`1 0 0 B R  H;PH0 `I1H0@@ 0 0C 0  S0X@{5P 0l@t5P 0 B R  H:PH0 `e1H0H0@W5P 00C 0S000| @,0,PHi H0 `D1H09H0t@55P00 00C 0SH2Px H0`&1@ ៱P $ @5PE 00C 0S000e  0P_ 0}L0 S4L< @ P h @?7\0@@ 0*57t0@@ 0 +70@@ 0!7@0@@0@4 P& 0A QL2P. 70@@ 070@@ 0S47,0@@0@@P 7p0@@ ۰R0@-@\MP3 0@ 0Cd1U.T0S 0s+ @ ῰D0S @ ᴰHQ L R @ ⧰P0S  㭰P\Ѝ0T0S@ ᓰ@-G@@9 0@〰| 0& @z@0 @t @/ 0@mA-`QhM@ 0Pd@@@@ @$@(@,@0@4@8@<@@@D@H@ / pP@1 PWb d1P` PhЍ 0p/V 0@ 0 B R  `P `0@/ 0 0C 0  S&0t@3P 0@3P 0$@3P 00C 0S000  0P_ 0S0pp000g0`0<@3P! `p@Pf 0 L0CPSTX\ 0 P LDL▯ L0~/ 00C 0S0009  0P 740@@ 0夯a70@@ 0嚯W d0-/]7,0@@ 0劯G7@0@@70@@ 0{827x0@@ 0p-@㬯P 7p0@@ jR0@-@\MP% 0D 0C/U H0S nP@ NLQ T0S  OTPQ :\Ѝ0@ 3@-G@@L> 0@ 0< @ ,0% @0 @ @/ 0@A-RMP 00@4 Q  ۮ1@s 0 `P. 0S0$@2P 00C 0S000  0Ph 0S`0`0f0Ѝ0t@|2Pp p@P00 00C 0SeqPM 0Pe. 0 0C 0  <@T2P 00C 0S000E  0P 7T0@@0$@92P3 00C 0S000*  0@P 7,0@@70@@ 0_g70@@ 0S70@@ S10@@ხP 7p0@@ A m7L 0@@["0-RA-xMP@ 0  D0C. @$L0S Q  0@H\  @0p%@ @`@@T 4 D1@@T+ @ \0S   `0S` `0V00@T0S @ ۭX0S @ ӭd0S @ ˭P0S @ t0S @ 席pQ JlQ hP  㴭hxЍQ@` @㚭VT @ ᑭQu  0@〭o@ ჭO-QM 0 $(,048<@DHLPT  .PP0 @`P-Pl00 00000C0Sh0h@0P` 00@0P` 08@0P5 0 B R  Z @P ,㬬pP   0P pW7@0@@ ЍWYGP  0,04@0 P80AQڄp.Pe0   VUd 0l, r  0d, 0_, 00   c 0S 0@m0 P0AQbڄ0.Ph0  ! L P @0x@L0 P%0AQAڄ.P20!07X 0@@ 0tk7 0@@% 0ja0@0 P60AQڄ-P$ 0+7| 0@@ 0F=/7@0@@ 0;27h 0@@ 01(7 0@@0@/P 0 B R  p 0-Sp-P%Xl 0+0|@/P$ 0 B R  ڄ }-P  0+ +7 0@@70@@ 0ګ0@/P. 0 B R  ڄ医P0s R  V+oX .PX0S) Sl03?07 0@@ 0夫0(@Y/ P0AQNڄ-P  0#+<`03?0t70 0@@0$@6/P00C0S000+ 0=P0!0<@/P00C0S000 0eP 7T0@@ 7,0@@0$@.P00C0S000 0)P 70@@0@.P 7 0@p@ &iR0@-@MP 0  0C+U Q 0S  Q Ѝ0@ @-G@@ ? 0@ @( 0@ߪ0@-PQM 0 @p  Ṫ1@s} 0P* 0SU0$@|.P 00C 0S000k  0P 70@@ 0姪;0<@\.P 00C 0S000K  0P 7T0@@0$@A.P 00C 0S0000  0HP 7,0@@P0P0e0Ѝ00@@ᡪP 7p0@@ _e70@@ U-70@@0 0AE-MpP@ 0)U:PE@U`@ 00S4 0)VPE@!`8@V P D@P PU` ߩ00S 0)VPE@0000j0ЍV-7L0@@O 0E-@QMpP00`` @Tg ⪩00SS@DTP@  P  @P7  @P1  @P6@DTʾ0S/ @ 0 b) 0@PPZ)v@ 0 `cPO)X0000jഠ @T  V00S` Ѝ 0/),R@-@MC 0  0C )0S R< @ W0S R( @ L0S  BR.4@ @0S  BR+h@ 4 0S @ 0"Ѝ70@ @070@ @070@ @07D0@ @0@-G@@D 0@0E @(0 @<0 @H@9 0@٨RG-VMPVߍ0S 0Cl)PaV 00C SJ:w8@p@o4@T@ (YL  T $@ 0ᱨ 0@ 娨0 @㢨0S T T 0T@嗨C4ں0ֺ,Һ<@ 0ᄨ@. 0rG-@QM{`DCR?\XT  $(,048^p@D TP B崹PUp@DT@PH }P X @wP 0mS$ DSR0PSOQLTP  PG0@@ @!<0 @@ 0iS0nS)0S&TP CgP 7\ 0@@ 0aS0xS0S TPl MP 7l 0@@P @ P TPY W)P 7| 0@@ @P TPF V'Pr 7 0@@u @PW  @PTP-  ㈧3YT1S P 1S \Q 1S X!R 4@P- TR  0A4P00XT!14P@ 0P2@3' B?4,'0 ̠%'0PP0p00pgpލTP @R/%P 7 0@@ 0E7\ 0@@ 0;UT p0PS0sSQ@T  PP{@T? 0DS  @WP@T  Up P00à? 70@@P0ST0S R@ 2XP  8XdЍ0  BR #3 @Q0@  BR\@  BRh@   BRx@ @-G@@@ 0@0/ @ߥ@? 0@إE-Q$M 0@@  㧥00S pW$Ѝ P 0`|%p5 pG0W0 p∥000S0P0SP 0_% p0pG p00W 0@ ѥ P 8 @˥ PpG0W0 pW00Sq 04%@ @㯥 PpG0W0 p;00SU 0%T @㓥P d @㍥PD t @㇥PpG0W0 pZPF 0$ 0$$ @dPpGW p7 0P& pWz0``000f0A> 0$]70@@ 0+70@@7,0@@ 0N(l @-@0ڤ@-@Q MPp P`@ PT @DT@ 0@$ ЍGp@@@ 弤@ 0孤(70@@Q/0塤70@@V 0噤780@ @囤R@-00CS RL@㉤0@-P DM@@ IX@ w0 ĵ`@ n 8h@ fDЍ0RG-@MD 0  0C$Z P 00C SEP`V 00C SDU`` pW 00C SpV   㘣P: Z  @ X @ W @ Ѝ70@@" 0pV 7p0@@ 0 P70@`@! 0@ gG-`M@Pp@000 0'P pGW@PpW @L@'P pGW⚴@PpW @@n'P&pGW ݳ@P00/ 0 @pP0S Ѝ7$0@@( 0厣@@@0p 000;'P pGWa @PwpWY @@)'P pGWOC@P`pWG @@'P:pGW=↳@P? Z0 Y> P faG +2 Q쏣jf  A{#@0@0 2 ` g{ Q} A{ T/0 @pL@@Y &k j&P 00C 0S000n,@  P@ 0P@0@"&PC 00C 0S000R  rPGp  @ ,0 "U  0 "W  0 !@@70@A @0#x0@%P 7 0@P@ f@qu%7h0@ @0Usp@-`R@p00CSpP@    @ p@@ܡ@-PQMp@0 `Ҽ0U= 0S#  `c#P&PEU@@p%P @j%P Ѝ 0c!70@@ 0嗡@7P0@@ 咡$ @(@0刡70@ @-@倡@R0@-@ M Ѝ000CSP @0i<@ 0cA-Q M@ 000 0FpPA` Ui  "PTXpPE`4X@$P @$P UO  "P @3\@$P4U; 000Cs R P10XpPE`P 0`P  0 0`0`0 00b0 ЍX @f7p0@@ TF$RE--PM 0 0Cm!`V@TIЍ00C+S@@$0Swp@ 勱(@ Ṡ, g~|@ ᬠ,0S g9{ @ ᛠ{ ޲@ ᒠ70@0S @ 0几00CS 0 @x70@P 00@#(s0l{ L`妲 p ᡲ 0@pR{  0Lc史 p ኲ @0p;$ @6wdp@@( .0Si p@ &cE-MM@Q;0H48=D@ȍ<ȍ  $(,088Vp P` U%  !PXpPE`Dڜ@#P  @#PU   d!P  @S @#PU !  h!P  @>p( @t#PrU !  S!P ( @)[hV 8[PS>0H8Sx D8S88e +k@(4ȝ,PH+4ȝ<(88 +PD`{+ 0`$( 0,!; 0p0 p0000jภTЍۍ@X @"P*Uh JPB X @mx`@Q#.88D}p@Q#.880H8x @"PU7  P @P@"P x@4P @.P-U ! ! 徰Px@]7t 0@@ 0Ӟ="7 0@@% 0Ȟz7 0@@* 0從p<@t"P D@P L@PU !   |PD @MX@מPU 8S!⻮P X @5@㿞PU 8S奮P~ @7` 0@@ 0c70@@@㚞P 7p0@@ X7 0@@ 0D7 0@@ 0Y   03 0( 0 0`00P$0PjP@0(Ѝ`$ p`n$08@P<@T$00$001|70@ @0`/$0@P $0$0@P``70@@!`g`70@@` 70@ @0` 0 0 nRA-XMP@ 0L 0C|T`V9 @P< 0 0CS ~ @p@q@ q\@ 0ɛ0 0@㺛x 0 @廛70@0S PQ 0@ 0ᡛXЍ(@ 0ᘛ7D0@@ 嘛@P00@@/O-pPDM@U 0h0p4p8ps>pppp p$p(p,p`<@#P @P/PU @<@`P ` 00SUn` 0 p` 0 0 0000b00P@DЍ@PPU  PV PU @V| X W% 0p @PPU 00pS0 PE~@@PWz0`(000@PXk0p(0`00(0SU Z@PPUk  Y@PPE@z 70@@ 0@vP70@@ 0尚|z| @0P,S70@@0 妚i70@@ 坚=70@@ 0勚WPE@2d@>PPU00 @70@@ 0r>p@(PPU00\@P PU00 @|@@ P H@PPU00 @fT@P`PU @[@-@ `0MRPp 0PL@PE 0 B R  Jڔ@P 0@P 0@P 0@P0 7|0@@0 Ѝ(  0kP 00007p0@@+ 07T0@@7,0@@ޙ?G@@C @0ʙ 0@ę! 0@㾙 0@㸙0+ 0@㲙\@ 0嬙70@@k 0墙RE-Mp@ 0 0C7XBT9 @0@ @3oSoo 0``\!`fE? P0 P@ Pd 0@ `Pq70@P \Q ⰬߍL@ 0SO-PdM@U 0`<@DHLPTX\x@PU @pP@\00\0U  P;1U 0c33?P X0   P,PE0U@T0U-<p 0p 0$000 00b0P@dЍ@P 7|0@@ 3d@P-PE@0D0U @PPEU4< N@PPE@ 70@@ 0嵘@kP, Xp@`P0PED0@\@UP0PED0@@IP H@CP0PED0@˜T@5PPE@D@-G@@ 0@j@!0@c@-P0@@ `R@-\M`A 0L 0CT@TI p @ @0 D4 0 @<70@0S"0S( 0@PP @,0\ 3?@<Ͽ"0P@S0@ 0\ЍPQ Y0Sx@ @ 0@-XP@AM@`V `V 'PAߍ& @0  ㉗`P &0 @  `P 0`0`xp@VqP`ŗ`P 00 )>0@0G-0 R@ P p!`Q $p(`,@70@@% 0偗p@-0@ T `P@03?1 p@70@: @0dp@-?pM`W@oOO P @0% R" 0S) wp̠'t,xp1qD@p 0 S Ѝ@H@70@ @0$Ѝ(@@ #30@@-@`PM\p00SD/ @p0 1R# 30Ѝ@K@ݖp@@ Ѝ@-P@(M S S a(ЍS    dP00 O-`0MQ@p DH  03D_P@ RjT T@@^P @! 0 B R 70T0r T @ '0S^00 00 ЍTf 0< @2P:00C0S 00 0\ 0  P 0 B R @P00C0S 00 0? @ 0eP00C0 00 0 @0@) 0 0@P@  0@P 0@ @ 0@0  @ {E-p `0,MRP@ 0,Ѝ$ %P $ B0R   @PS 0 B R  ^ @ P8 0A Q   MWP  B0R   > G P A0Q .8P 0 0C 0S0 000  p` 00000@JP 0@AP }p@-` 0M0PR@, (0 @     %P,00C,0S(00(0*,( 0K,00(000Ѝp(0 ̔,0SSP (, 04*hh 0000h 0嶀 pP`@ PpVm 0Pr@ DЍ7 0@@ 0Lh 00h 40 >0d@P/pI0W$05P@PpGW+ PPpGP 70@@ 0 7 0@@ 0p@PpI0W$0]@P,7$ 0@@ 0ߒ\@PpI0W$0>@P H@PpI0W$0,T@wP ppI$W /E-`0MPS@p0^ sR dR  sR tR R0C 0 000p`0000Ѝ rR$ @7P4 0iS<0hS90lS6 R300C0SM  0p` cR R0C 0 08@㊒P 00CS0%   @uP 00C0S 00 @P00C0S000ʂ@QP00C0S00 0?p`9r@8P00C0S00 0p` Y0cS dSV0fS.0S+00C0S00 0@p`;0eS0S00C0S00 0p`"@P900C0S0Ä0 0p` tR oR  sR  RC mS0fS0S00C0S_00 0 p`$@㨑P 00C0S0ÿ,@㘑P00C0S600 ///4 @FSA-`P7 *"*S;:R p@@ 20@:#:S"50:#:S p@ @00 .#0:#:S0D@ #2 7 0@@ 07$ 0@@ 0O-pRM 0Ss @Tf P ` @ Pq XP p`s  @T, R R`\ @PP[ X: 00lS nS tSP °pPg U0 0@@' @PTZ# 0  <à`hw 0 r  n0 0@@Ѝ0, 0@@߰0t0@@ְ0 0@@̰0 0@@°0X0@@幰0 0@@寰D @B S8@-P@R Q3 Q7 0t @00 R 0 00 S, S1 @ 8@ 0 0@  00  0@h  0@l  0@  0@  0@7L 0@@ 0ُ8O-0R *R0b  TRh X<``FVE@0VQ  py@ p4V";p p00 .1V",W> 00CS<p @ X00CS7$ 0@@' 0d @ @L @ ppVʉ7 0@@ 0֌7 0@@% 0ʌ0@-M@ c P)PU5 00CSP CPQ! :Q  0@㦌 17 0@@ 0噌Ѝ0  0@㎌  0@㈌7 0@@ 0l0 0@ p@-PP* @ *R@!   P2@Tg`@vS fT 0 @iS 0 "Sp0pp@O-@RtM0d0h0 RF@kPAW0 P@J@` *~0+  @@-T% 0S @ $  @ 0S  @ iSP vS9 0S? 0@$ @T @9 0!`V> `Pv V pWKl @Pp4gp pWH  8@CtЍ$⡋$0  @ऋ0S $▋$0 @0$⌋$0  @pP0 * `&p @׋Pp t@ ϋP  7@Xs ` p06w W   X7@l@P*U` 0lpPp@ <  X P0S 2 R0uP iR vR 7 0@@W `V] P@@vPQ pW\ Lpb f `VK R RA8@aP< pWG 7pP\ ` 5@匫G(p`*& pl0`@00l@ ֊  [0P0Sy*X`0  5@]  4@SH  4@J``  4@?0   \4@0 0  d0s 6#&:0 00g 6#:J0 00Z Rp0 P#N Pp0 `#B  2b0v` iR vR 7 0@@v6s06 &#R 3 ::u hPU &6*::6 p`W R@@~P XW TpH j pR8@mP XF Cp`b p:  0*S šl 0 @ P"ȇ@`V @ 0iS Z vSN   |1@x2dP &6*::6p`  1@aH  *S šl 0 @ Q"ȇ@`V @ 0iS $ vS ׉  t0@60&"S&**66c00&"S&**66W0x0 3@-0C@@T[80@ @ 8@-80@P@T@T щP8O- Mp[`5 0 `S0S. 0P@PT80@0<0s ?U Š2@T` `: 0 20 00 Ѝ `80@`0<0K 80@  /80@  /@-70@)  @ @@0,fGP@@- -) M9 0@@ @  7 U U I 6 0@O-@$pLj@Ĉ@@@Mྈ `@ḈTP ᱈ ဈU ᩈ x᷈ᴈш 0  : 0 p)8 @0}p@dP- `ὈP `ᶈpP `PG T$K0 10pdW:l 0 1 0Y P0H @0͈+P8 @0ˆ PH @0᷈Pr70@`岈 `PWP@夈 _( @X @-M0@ @ 儈ЍHC- MP@`q ؂p ׇ0 P ЍV SR3#"\Q YX3# Q0 @-M@ 0 00Ѝ@-M@000ЍA-M `b @Pp.m 0P@ pp 00U 0p 00Ѝ H0@-@P M00 Q,PT ◇ Ѝ0 P@0P T0P80S 3/T0$  Td @?և@-PR$M@e | @=0@P*  @ 0 0C RT  @ | 0Sc  9 0@ @!qpW` Ppe`Pb PE0SLP@P  0 4 @ND0 T3/0S) x @ J0S  @ B70@0S Q ₚ 0@( |$Ѝ ' 0@\  0@7( 0@@  @ 0 @ 07@ 0@@ O-M|  @ 00 o=0@P*  @ \P @ PUP <@ PX0@@pP 0@ +  @PuGp ` v# jV STT  X0 Pp `<~0S T 0S 0@-@Q MP Ѝ00S %~0S T 00S0P0#S 0@-@Q MP Ѝ00S ~0S T 0PS00 0@-@Q MP Ѝ00S }0S T 00S0 P0S pš0@-@Q MP Ѝ00S }0S T 0PS00pť0A-P@0 Mp~P 0aS :W}`P& W6 WW00@ Ѝ0lS0lS0S W Wp00000nS0yS0S WW `` T}P0000p  Pڶ000000p  O}P0T@ P X .P 0000괕0@-P@04Mp}PE 0aS0nS10yS0S9 /| `P00N@P0 S00 S 0000V p, pP,0" S@V /004ЍlS0lS0S 000 W@ 0p0@0 P0S 20P@ꨓ8@-R\@P@ P8D0 @0|} 0 0|}`Mx8@-R\@P@ bP8D0 @0|| 0 0||Lx@-@(M 800P(Ѝ  0||XLx@-$00 000||Kx@- 0 00||Kx, ( @-0q||Kxx, @-0  a||@Kx\, @-0  Q||KxPp@-P`|@|T p@{p@-r@P` p@ `!100"!{P 0@-MPA M@{P { {PPdP Ѝۍ0A@{P% {  0 !| {@PdP + ;;|P dPd{@2$0@RT[{UdPh@@]{P Y{L  0 {4 htHA--@MP.p>{b`P 4{ A ZЍ s{ gX T2@0Sq 000S` 000{PT {PN {PH  {PV {PP zPJ zPK zPE zP? tzP@ `zP: LzP4 8zP $zP zP 0: ({g z SZ*00|0 : (0 : (0 : (@@.AeAxH|$XLPKpK(KKKJJؾȾ_zp@-M@P(@ Q*$(&%$#" ` 00f00 001z  0Ѝp 0 0zHO-MlR@0`@PX2p00S) Tm PU 0D @@ O20) i 1S0 X 0 S 0T  yP+@ @ЍO0~zP 0 @0  DzL1 0  PE (10'z  JzP zP Ѝ@0S 0S  r@  @ @0D@ 0@ S񏐵 0@ @ 0 @@uyDlcTbtO-@Q MP S`Dp`:U  PEKzp VU` 0PE0T ЍR@-@0:Q) Q' P`b:Q Q 0AaAWpA|p \PwAA7ApqP@VS`ķ0Q :QS``ķ0QR cXyp@-@M` @@ly yyPvy P@E0yЍp`O-M 0PyX! PCH1#`@p000y$10P  `0(@!H@y0#00@`x P@0`06y2y0yP` pyy`Fy 0`PЍ ,0 0 09y`@pxE-`@P@PAyP JZp Wp2yP1  0p(0$ 00yKyt>x4 O-M M|ax`PPL lqllp  pxP> 2 S S? =@0 S S #S S S + 0xP + 0xP +  0xP + 0xPDT Tx 1xP*x ЍۍO4 0(xꘛ=8xĴ0 0 _HEX00-0P@PL@HD< 8 Pǃ '0l,E^|<tp 0 0 ^D8 0 0 N ^pDE-M Maw`PPU q嘁嘡p  wPG 2 S S? F@0 S S #S S S + 0wP +  0wP + 0wP + 0wP4S x4@02x41/  OtwPmw ЍۍO@ 0<4  w Ș: d$dxرh 0 0 ~\P00@-@ M|PPP Ѝ0\  wLQ <  w 0 P,B,[A-P`M@`P wP 00S ĀpHp W `V wP00`ppЍ00 JwP0 0RT 0SP0[[TAZZP00@-@ MQP Ѝ0\  twLQ 8  hw  Ph@dY4A-P`M@`P fwP 000S Āpp W `V RwP00` ppЍ 00| vP0 0R T 0SPhYHY?XXP00@-@ MQP Ѝ0\  wLQ 8  v \ P>XhA-P`M@`$P vP 000S Ȁp p W `V vP00$`(ppЍ(00' cvP0 0R(T 0SPW|W=(WV0p@-0P@0`S h0 01?S0S  R@p( 0 vp~V\jE-P` M@`,P vP+ 000S$ 00>C C`V`V pmvP0 0,p0 Ѝ X u0SC000T 0S UU[`UP00@-@ MQ P Ѝ0\  vL Q 8  v P;TA-P`M@`4P vP 00 0S Ȁp࿎ p W `V uP004`8ppЍ800R uP0 0R8T 0SPTS4:S\S< @-#8`S@ `.P \8001@  ux-P-T@-@|`pP`P.U 1tP1s0,#4"80 P0,#4"80,A-`P@pP0P uP \ `t t0@@$ 0 TuPLQQh00@-0 MP@TVuP 000Cs0 St@P \0 T0~t@ Ѝ0 P@ @K\QTK Q Pp@-@P` /uPa00p)u QP 0s#4V 4, ,L#Š ! V0 !L|V0  .V ;#;S":1 V ?Cs0 0V  LA1Cs0CQP 00V000ECP LC 0V 0Cs0 Pp@-@P t0a pt00 R0 0 B R R10P0 @s0?S.P 0p`Q0 0A Q  Q! \0Lr  R*5 00 Pp@-@P` ytPa00pstV00  V2/ 2!A  R70 Ň ŗ0SV 0.V@ ! Q70ŇŗV 0 Q70ŇŗS V00p@-70@ 2 Ab1 QQ 70@f {!k / 70@f {k / 70@f {!k / 70@f {k / 70@F f++bak{g{!k /.A70@F `k{ g fa {k / .A: :J 2 P50/Q!R/: :J 2 P50/S 0R-`@P(J@z F;,+0zJ50 \1V @Bᄠ \@J SF ``k{g { kj0 0/S  3 \ .AO-@P MU 0S00000 Ѝ R' P<`@a0R000s02V:0+sP 5㪚J00Z 0 `0S @J "R 1Ur pR 2,R00 @-@M@r@P ,  @ 03sP]r0, +CS :7g;0@ g+ *g ` ЍCr.A`Q/ѐ1+C  p / P/ @- -g*g  g :`9˛Z@ @H˰ (H {+S0 Q r1 Aa { @ T@-@PU` Zp+p2 Qr z);f 2 Ab + R 2: Z00  { k pP#S00  @@--@(3*\P:櫸  +gf b+yb;y# g;2 Q죻fa+2+S`;q0 Aɛ0 iH ` h {!k @0.A@-- \% @*\3:f ; f+g# I8`: L Qf `1+SuqI81 A q 0 h {!k @  ȋ0 h.A8@--0 0@@P  ą4 PPRu8L|  0P gg00s00S 3: `x1 Qq1 Aa 00Cs000Cs0S3#0S/ 0SP//O-Mp0W`000 000ڜ@;PpGW 0S P@GPTpGI @ P@P  @PWn 0Su  P   @@( @PWX 0Sg eP (  @@4 @P%WB 0SU P 4 < @@0S pP@ Ѝ 0S0S X @PW 0S!P X P @@7< 0@@!0pU  @@o @{ @wX @s( @o4 @k0 0@-lM@P\0Cf`Q D0D0 BH0R #L0P0T0X0p qLP!H RP RT R X RlЍ0 @p @p @pt @p׃d @ p Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/PQ @-@A/!1#0@-@P40 JZtPe@ 0!"# 0!6U0@/Ơ! p6#6 r04i @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rk*\0@/@D1040 R"(!0C" R"$!0C"R""!0C"R0C"0C01C S  b 1 b0@T0@/@@T @@ d010@/ @d d00@/10@/46#!@PE 40 0@/10@/ʰ#0@/E20@8/1Q0@/0 FV10@/0/0@-K2@P0/0@-K2@Q`B| a43!/23/0@-MQl /0@-P /0@-QZpK2@!˰D    ! 0bà01@7SRQPM`-.Ѝ /@-o@/ Akk'Kd[ kF{k*00@-J/=A@-@pP`$q'0PU`0`@/@-@pP`+$q'0PU`0`@/O-pQM@Ppp@UP r0PPPUX1 P 0`43*X ? h&h u)xxW* pH*WH2 p0pd*@b )Y* @D*Y@D2X Ppj`0  P`74U*P  x'x` 9%88S* 0`F*S`F2 00@d  &X%XXU* PH*UH2 P0pgh*  X%X )xxW* pH*WH2 p0pd  @ )Y* @D*Y@D2^U`Zn`PWT@3@##Q*N 0f8#743Vv%  p)  "[*H*[H20 g   p 8#88 S*0pG* SpG2000iP(%x  " (,Q00R``V H``Q0@ 0s@ЍO/O-`SP@pR1P 0`53p)X0 h&hf+xxW* pH*WH2 p0pd@S +[* @D*[@D2R P@ip0  `45)h H$Hp *(Z* pG*ZpG2 0 e P (X* PE*XPE2 0@dx)X h&h +88 S* 0H* SH2 00j @ +[* @D*[@D2_VY`pPTU@3@##S*P 0g8#453gG@&H)  "88 S*0J* SJ200k s 0H$HH T*@H* TH2@0@i `(&8  8"( 8S00RppW Hppp ЍO/P !A" P !A"P !A" /E-`p@k< PjEQ@1 @3/T:  /@-100823fh %08x [Unknown filter, optlen=%u] fh %08x [Unknown qdisc, optlen=%u] Unknown qdisc "%s", hence option "%s" is unparsable Usage: tc [ OPTIONS ] OBJECT { COMMAND | help } tc [-force] -batch filename where OBJECT := { qdisc | class | filter | action | monitor } OPTIONS := { -s[tatistics] | -d[etails] | -r[aw] | -p[retty] | -b[atch] [filename] } qdiscfilteractionsmonitorhelpObject "%s" is unknown, try "tc help". Cannot open file "%s" for reading: %s Cannot open rtnetlink Command failed %s:%d Unknown filter "%s", hence option "%s" is unparsable Unparsable filter ID "%s" %s/q_%s.so%s_qdisc_util%s/f_%s.so%s_filter_util-stats-statistics-details-raw-pretty-Versiontc utility, iproute2-ss%s -iec-help-force-batchOption "%s" is unknown, try "tc -help". Usage: tc qdisc [ add | del | replace | change | show ] dev STRING [ handle QHANDLE ] [ root | ingress | parent CLASSID ] [ stab [ help | STAB_OPTIONS] ] [ [ QDISC_KIND ] [ help | OPTIONS ] ] tc qdisc show [ dev STRING ] [ingress] Where: QDISC_KIND := { [p|b]fifo | tbf | prio | cbq | red | etc. } OPTIONS := ... try tc qdisc add help STAB_OPTIONS := ... try tc qdisc add stab help Not a qdisc Wrong len %d print_qdisc: NULL kind deleted qdisc %s %x: dev %s root parent %s refcnt %d pfifo_fastprio[cannot parse qdisc parameters]devhandleinvalid qdisc IDrootError: "root" is duplicate parent ID ingressError: "ingress" is a duplicate parent ID parentinvalid parent IDestimatorstabqdisc '%s' does not support option parsing Garbage instead of arguments "%s ...". Try "tc qdisc help". failed to calculate size table. Cannot find device "%s" Duplicate parent ID What is "%s"? Try "tc qdisc help". Cannot send dump requestDump terminated addchangereplacedeletelistshowlstCommand "%s" is unknown, try "tc qdisc help". Usage: tc class [ add | del | change | replace | show ] dev STRING [ classid CLASSID ] [ root | parent CLASSID ] tc class show [ dev STRING ] [ root | parent CLASSID ] QDISC_KIND := { prio | cbq | etc. } OPTIONS := ... try tc class add help Not a class print_class: NULL kind class %s %s leaf %x: [cannot parse class parameters]classidinvalid class IDError: try "classid" instead of "handle" Error: "root" is duplicate parent ID. Error: Qdisc "%s" is classless. Garbage instead of arguments "%s ...". Try "tc class help".What is "%s"? Try "tc class help". Command "%s" is unknown, try "tc class help". Usage: tc filter [ add | del | change | replace | show ] dev STRING [ pref PRIO ] protocol PROTO [ root | classid CLASSID ] [ handle FILTERID ] [ [ FILTER_TYPE ] [ help | OPTIONS ] ] tc filter show [ dev STRING ] [ root | parent CLASSID ] FILTER_TYPE := { rsvp | u32 | fw | route | etc. } FILTERID := ... format depends on classifier, see there OPTIONS := ... try tc filter add help Not a filter print_filter: NULL kind filter protocol %s pref %u [cannot parse parameters]Invalid parent IDpriorityinvalid priority valueinvalid protocolMust specify filter type when using "handle" Garbage instead of arguments "%s ...". Try "tc filter help". We have an error talking to the kernel invalid preference What is "%s"? Try "tc filter help" Command "%s" is unknown, try "tc filter help". -?-@ .@@/0A..A/A .eA/pB/mB/ @/@/@@/`A0^A0B0eA0B 0B/usr/lib//tc/TC_LIB_DIRnone:%x%x:%x:%x???%.0fMibit%.0fKibit%.0fbit%.0fMbit%.0fKbitsecsmsecmsecsususecusecs%.1fs%.1fms%uuskbgbgbitmbmbitkbitb%gMb%gKb%ub%g%%continuepassdropreclassifypipestolenshot%d%cethernetatmadslunspecunknown installed %u sec used %u sec expires %u sec%sSent %llu bytes %u pkt (dropped %u, overlimits %u requeues %u) %srate %s %upps %sbacklog %s %up requeues %u %sSent %llu bytes %u pkts (dropped %u, overlimits %u) rate %upps backlog %up mibitgibittibittbitBpsKiBpsKBpsMiBpsMBpsGiBpsGBpsTiBpsTBpsUnknown message: length %08d type %08x flags %08x fileUsage: tc monitor Argument "%s" is unknown, try "tc monitor help". Cannot fopenIllegal "%s" [NULL police tbf][truncated police tbf] police 0x%x burst %s mtu %s [%08x] peakrate %s avrate %s action %s/%s overhead %ub ref %d bind %d buffermaxburstDouble "buffer/burst" spec minburstDouble "mtu/minburst" spec Double "mpu" spec Double "rate" spec avrateDouble "avrate" spec peakrateDouble "peakrate" spec actionconform-exceedIllegal "action" Usage: ... police rate BPS burst BYTES[/BYTES] [ mtu BYTES[/BYTES] ] [ peakrate BPS ] [ avrate BPS ] [ overhead BYTES ] [ linklayer TYPE ] [ ACTIONTERM ] Old Syntax ACTIONTERM := action [/NOTEXCEEDACT] New Syntax ACTIONTERM := conform-exceed [/NOTEXCEEDACT] Where: *EXCEEDACT := pipe | ok | reclassify | drop | continue Where: pipe is only valid for new syntax "burst" requires "rate". "peakrate" requires "rate". "mtu" is required, if "peakrate" is requested. TBF: failed to calculate rate table. POLICE: failed to calculate peak rate table. Usage: ... estimator INTERVAL TIME-CONST INTERVAL is interval between measurements TIME-CONST is averaging time constant Example: ... est 1sec 8sec invalid estimator intervalinvalid estimator time constantError: estimator parameters are out of range. [estimator i=%u e=%u] [Unknown action, optlen=%u] Unknown action "%s", hence option "%s" is unparsable Unknown action "%s" usage: tc actions * Where: ACTSPECOP := ACR | GD | FL ACR := add | change | replace * GD := get | delete | * FL := ls | list | flush | ACTNAMESPEC := action ACTISPEC := ACTSPEC := action [INDEXSPEC] INDEXSPEC := index <32 bit indexvalue> ACTDETAIL := Example ACTNAME is gact, mirred etc Each action has its own parameters (ACTPARAMS) %s/m_%s.so%s_action_utilgactnoactbad action parsing bad action empty %d parse_action: bad value (%d:%s)! NULL Action! %s Action statistics: action order %d: Error printing action print_action: NULL kind Flushed table deleted action Added action Error: non existent action: %s Error: no index specified action: %s bad action %s We have an error flushing getflushCommand "%s" is unknown, try "tc actions help". em_%s.so%s_ematch_util/etc/iproute2/ematch_map%d %sematch map %s corrupted at %s NOT ( [unknown ematch %d] AND OR Missing ematch tree header Missing ematch tree list Ematch tree header size mismatch %02x<<: %s ... >>%s<< ... %s(>>%s%s)... Usage: EXPR where: EXPR := TERM [ { and | or } EXPR ] TERM := [ not ] { MATCH | '(' EXPR ')' } MATCH := module '(' ARGS ')' ARGS := ARG1 ARG2 ... Example: a(x y) and not (b(x) or c(x y z)) Parse errorUnknown ematch "%s" Error: Unable to find ematch "%s" in %s Please assign a unique ID to the ematch kind the suggested entry is: %d %s AND OR , expecting %s or %s   @@@@@@@AAA AAA$A,A4A@Asyntax error, unexpected %s        $$&(02;BLNSU[\      !#$       Stack nowtoken %s (nterm %s (%d.%d-%d.%d: DeletingStarting parse Stack size increased to %lu Entering state %d Reading a token: Now at end of input. Next token isShiftingReducing stack by rule %d (line %lu): $%d = -> $$ =syntax errorError: discardingError: poppingmemory exhaustedCleanup: discarding lookaheadCleanup: popping$enderror$undefinedERRORATTRIBUTEANDORNOT'('')'$acceptinputexprmatchargsrelationinvert      *++*,*,**,,,-***,*,,,-**********.,,**/*******Y[[K[[)H3[<[[[[[[[>@C[[KPUM   /  %%&&((+++++,.,,-- -*************************     %&) !"$&&(&&&$&&'#*************************out of dynamic memory in ematch_ensure_buffer_stack()out of dynamic memory in ematch__create_buffer()%oerror: octal escape sequence out of range error: invalid octale escape sequence %xerror: hexadecimal escape sequence out of range fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowmatch argument too long. out of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in ematch__scan_buffer()out of dynamic memory in ematch__scan_bytes()bad buffer in ematch__scan_bytes()bfifolimit %slimit %upUsage: ... <[p|b]fifo | pfifo_head_drop> [ limit NUMBER ] limitIllegal "limit" What is "%s"? pfifopfifo_head_drop allot %d limit %up quantum %s flows %u/%u perturb %dsec Usage: ... sfq [ limit NUMBER ] [ perturb SECS ] [ quantum BYTES ] quantumperturbIllegal "perturb" Illegal "limit", must be > 1 sfq marked %u early %u pdrop %u other %ulimit %s min %s max %s ecn ewma %u Plog %u Scell_log %uUsage: ... red limit BYTES min BYTES max BYTES avpkt BYTES burst PACKETS probability PROBABILITY bandwidth KBPS [ ecn ] Illegal "min" Illegal "max" Illegal "burst" avpktIllegal "avpkt" probability%lgIllegal "probability" bandwidthIllegal "bandwidth" 10MbitRequired parameter (min, max, burst, limit, avpkt) is missing RED: failed to calculate EWMA constant. RED: WARNING. Burst %d seems to be to large. RED: failed to calculate probability. RED: failed to calculate idle damping table. redUsage: ... prio bands NUMBER priomap P1 P2...[multiqueue] bandsIllegal "bands" priomapError: duplicate priomap multiqueueIllegal "priomap" element "priomap" element is out of bands "priomap" index > TC_PRIO_MAX=%u offbands %u priomap multiqueue: %s burst %s/%u mpu %s mtu %s/%u mpu %s minburst %s limit %s lat %s overhead %dUsage: ... tbf limit BYTES burst BYTES[/BYTES] rate KBPS [ mtu BYTES[/BYTES] ] [ peakrate KBPS ] [ latency TIME ] [ overhead BYTES ] [ linklayer TYPE ] Double "limit/latency" spec latencyDouble "overhead" spec Both "rate" and "burst" are required. Either "limit" or "latency" are required. TBF: failed to calculate peak rate table. tbfUsage: ... cbq bandwidth BPS rate BPS maxburst PKTS [ avpkt BYTES ] [ minburst PKTS ] [ bounded ] [ isolated ] [ allot BYTES ] [ mpu BYTES ] [ weight RATE ] [ prio NUMBER ] [ cell BYTES ] [ ewma LOG ] [ estimator INTERVAL TIME_CONSTANT ] [ split CLASSID ] [ defmap MASK/CHANGE ] [ overhead BYTES ] [ linklayer TYPE ] Usage: ... cbq bandwidth BPS avpkt BYTES [ mpu BYTES ] [ cell BYTES ] [ ewma LOG ] borrowed %u overactions %u avgidle %g undertime %gminidleboundedborrowisolatedsharingewmaewma_log must be < 32 cell"prio" must be number in the range 1...%d allotweightsplitInvalid split node ID. defmap%08x/%08xInvalid defmap, should be MASK32[/MASK] CBQ: failed to calculate rate table. CBQ: avpkt is required for max/minburst. CBQ: bandwidth&rate are required for max/minburst. CBQ: "allot" is required to set WRR parameters. cell must be 2^n CBQ: too short rate opt CBQ: too short lss opt CBQ: too short wrr opt CBQ: too short fopt CBQ: too short overlimit strategy %u/%u cell %ub mpu %ub prio %uprio no-transmitweight %s allot %ub level %u ewma %u avpkt %ub maxidle %s minidle %s offtime %s split %s defmap %08xCBQ: bandwidth is required parameter. CBQ: "avpkt" is required. cbqUsage: ... rr bands NUMBER priomap P1 P2... [multiqueue] "priomap" index > TC_RR_MAX=%u rrbands %u/%u Usage: ... multiq [help] multiqUsage: ... netem [ limit PACKETS ] [ delay TIME [ JITTER [CORRELATION]]] [ distribution {uniform|normal|pareto|paretonormal} ] [ drop PERCENT [CORRELATION]] [ corrupt PERCENT [CORRELATION]] [ duplicate PERCENT [CORRELATION]] [ reorder PRECENT [CORRELATION] [ gap DISTANCE ]] options size error limit %d delay %s %s loss %s duplicate %s reorder %s corrupt %s gap %luIllegal %u time (too large) delaylossreordercorruptgapduplicatedistribution%s/%s.distNo distribution data for %s (%s: %s) %s: too much data reordering not possible without specifying some delay gap specified without reorder probability distribution specified but no latency and jitter values netemUsage: ... rsvp ipproto PROTOCOL session DST[/PORT | GPI ] [ sender SRC[/PORT | GPI ] [ tunnelid ID ] [ tunnel ID skip NUMBER ] Where: GPI := { flowlabel NUMBER | spi/ah SPI | spi/esp SPI | u{8|16|32} NUMBER mask MASK at OFFSET} POLICE_SPEC := ... look at TBF FILTERID := X:Y NOTE: CLASSID is parsed as hexadecimal input. spi/esp 0x%08x spi/ah 0x%08x flowlabel 0x%05x u32 0x%08x mask %08x at %drsvpfh 0x%08x flowid %s tunnel %d skip %d tunnel [BAD] skip %d session [INVALID DADDR] session [NONE]%s session NONE ipproto %s tunnelid %d sender [BAD]sender [NONE]%s spi/ahgpi/ahspi/espgpi/espflowlabelmaskIllegal "handle" sessionIllegal "session" senderflowspecIllegal "sender" ipprotoIllegal "ipproto" flowidIllegal "classid" tunnelidIllegal "tunnelid" tunnelIllegal "tunnel" skipIllegal "skip" policeIllegal "police" ݆nexthdr+ match %08x/%08x at %s%dUsage: ... u32 [ match SELECTOR ... ] [ link HTID ] [ classid CLASSID ] [ police POLICE_SPEC ] [ offset OFFSET_SPEC ] [ ht HTID ] [ hashkey HASHKEY_SPEC ] [ sample SAMPLE ] or u32 divisor DIVISOR Where: SELECTOR := SAMPLE SAMPLE ... SAMPLE := { ip | ip6 | udp | tcp | icmp | u{32|16|8} | mark } SAMPLE_ARGS [divisor DIVISOR] FILTERID := X:Y:Z NOTE: CLASSID is parsed at hexadecimal input. match IP srcmatch IP dst match IP ihl %u match IP dsfield %#x match IP protocol %d %s %s/%d match sport %u match dport %u match sport %u, match dport %u0x*fh %s order %d ht divisor %d key ht %x bkt %x %sflowid %s terminal flowid ??? link %s Broken perf counters (rule hit %llu success %llu) Invalid mark (kernel&iproute2 mismatch) mark 0x%04x 0x%04x (success %d) (success %llu ) offset %04x>>%d at %d plus %d eat hash mask %08x at %d input dev %s %hhx:%hhx:%hhx:%hhx:%hhx:%hhxparse_ether_addr: improperly formed address '%s' u32u16u8ipdsfieldprecedencenofragfirstfragdportsporticmp_typeicmp_codeip6udptcpicmpcodemarkIllegal "mark" value Illegal "mark" mask Illegal "mark" (impossible combination) etherUnknown match: ether %s Illegal filter ID Illegal "match" offsetplusatoffset "at" must be even shifteatIllegal "offset" hashkeyIllegal "hashkey" divisorIllegal "divisor" orderIllegal "order" Illegal "link" "link" must be a hash table. Illegal "ht" "ht" must be a hash table. sampleIllegal "sample" "sample" must contain exactly ONE key. Illegal sample "divisor" indevIllegal indev "order" contradicts "handle" to %s from %s fromif %sUsage: ... route [ from REALM | fromif TAG ] [ to REALM ] [ flowid CLASSID ] [ police POLICE_SPEC ] CLASSID := X:Y toIllegal "to" fromIllegal "from" fromifIllegal "fromif" handle 0x%x/0x%x handle 0x%x classid %s input dev %s Usage: ... fw [ classid CLASSID ] [ police POLICE_SPEC ] Illegal "handle" mask Illegal fw "action" Usage: ... basic [ match EMATCH_TREE ] [ police POLICE_SPEC ] [ action ACTION_SPEC ] [ classid CLASSID ] Illegal handle "%s", must be numeric. Illegal "ematch" mmm m,m8m*`d default [grio] GRED received message smaller than expected DP:%d (prio %d) Average Queue %s Measured Queue %s Packet drops: %d (forced %d early %d) Packet totals: %u (bytes %u) limit %s min %s max %s setupIllegal "setup" DPs =%d Illegal "DPs" GRED: only %d DPs are currently supported "default DP" must be defined after DPs "default DP" must be less than %d grioIllegal gred setup parameters DP =%u Illegal "DP" Required parameter (min, max, burst, limit, avpkt, DP) is missing GRED: failed to calculate EWMA constant. GRED: WARNING. Burst %d seems to be to large. GRED: failed to calculate probability. GRED: failed to calculate idle damping table. gredhandle 0x%04x hash %d mask 0x%04x shift %d fall_through pass_on Usage: ... tcindex [ hash SIZE ] [ mask MASK ] [ shift SHIFT ] [ pass_on | fall_through ] [ classid CLASSID ] [ police POLICE_SPEC ] fall_throughpass_on---------------- Usage: ... ingress Usage: ... hfsc [ [ rt SC ] [ ls SC ] | [ sc SC ] ] [ ul SC ] SC := [ [ m1 BPS ] [ d SEC ] m2 BPS m1 : slope of first segment d : x-coordinate of intersection m2 : slope of second segment Alternative format: SC := [ [ umax BYTE ] dmax SEC ] rate BPS umax : maximum unit of work dmax : maximum delay rate : rate Usage: ... hfsc [ default CLASSID ] default: default class for unclassified packets HFSC: Illegal "%s" default %x m1 %s d %s m2 %s HFSC: truncated realtime option HFSC: truncated linkshare option HFSC: truncated upperlimit option sclsulm1m2umaxdmaxHFSC: umax given but dmax is zero. HFSC: Service Curve has two zero slopes HFSC: What is "%s" ? HFSC: no parameters given HFSC: Upper-limit Service Curve without Link-Share Service Curve period %u work %llu bytes rtwork %llu bytes level %u HFSC: Double "default" hfscUsage: ... qdisc add ... htb [default N] [r2q N] default minor id of class to which unclassified packets are sent {0} r2q DRR quantums are computed as rate in Bps/r2q {10} debug string of 16 numbers each 0-3 {0} ... class add ... htb rate R1 [burst B1] [mpu B] [overhead O] [prio P] [slot S] [pslot PS] [ceil R2] [cburst B2] [mtu MTU] [quantum Q] rate rate allocated to this class (class can still borrow) burst max bytes burst which can be accumulated during idle period {computed} mpu minimum packet size used in rate computations overhead per-packet size overhead used in rate computations linklay adapting to a linklayer e.g. atm ceil definite upper class rate (no borrows) {rate} cburst burst but for ceil {computed} mtu max packet size we create rate map for {1600} prio priority of leaf; lower are served first {0} quantum how much bytes to serve from leaf at once {use r2q} TC HTB version %d.%d lended: %u borrowed: %u giants: %u tokens: %d ctokens: %d r2qdebugprio %d quantum %d ceil %s burst %s/%u mpu %s overhead %s cburst %s/%u mpu %s overhead %s level %d cburst %s buffer [%08x] cbuffer [%08x] r2q %d default %x direct_packets_stat %u ver %d.%dcburstcbuffercmaxburstceilDouble "ceil" spec "rate" is required. htb: failed to calculate rate table. htb: failed to calculate ceil rate table. htbhtb2Usage: ... drr quantum SIZE Usage: ... drr Illegal "quantum" deficit %s drrUsage: ... gact [RAND] [INDEX] Where: ACTION := reclassify | drop | continue | pass RAND := random RANDTYPE := netrand | determ VAL : = value not exceeding 10000 INDEX := index value used netranddeterm[NULL gact parameters]gact action %s random type %s %s val %d index %d ref %d bind %dokbad action type %s randomIllegal "random type" Illegal probability val 0x%x Illegal probability val 0x%x Ђ[NULL mirred parameters]Cannot find device %d mirred (%s to device %s) %s index %d ref %d bind %degresswas expecting egress (%s) mirrorCant have both mirror and redir redirectmirred: Illegal double index mirred: Illegal "index" mirred bad arguement count %d mirredmirred bad arguement %s mirred ingress not supported at the moment Usage: mirred [index INDEX] where: DIRECTION := ACTION := INDEX is the specific policy instance id DEVICENAME is the devicename mirred option not supported %s Egress RedirectEgress MirrorIngress RedirectIngress MirrorUsage: ... nat NAT NAT := DIRECTION OLD NEW DIRECTION := { ingress | egress } OLD := PREFIX NEW := ADDRESS [NULL nat parameters] nat %s %s/%d %s %snatIllegal nat construct (%s) Pedit: Illegal "index" Usage: ... pedit munge Where: MUNGE := | := [ATC] OFFSETC:= offset ATC:= at offmask shift NOTE: offval is byte offset, must be multiple of 4 NOTE: maskval is a 32 bit hex number NOTE: shiftval is a is a shift value CMD:= clear | invert | set | retain := ip | ip6 | udp | tcp | icmp For Example usage look at the examples directory Unknown action hence option "%s" is unparsable [NULL pedit parameters] pedit action %s keys %d index %d ref %d bind %d key #%d at %d: val %08x mask %08x pedit %x keys %d is not LEGITp_%s.sop_pedit_%soffsets MUST be in 32 bit boundaries pack_key32: 32 bit offsets must begin in 32bit boundaries pack_key16 bad value pack_key16 bad index value %d pack_key16: Final val %08x mask %08x pack_key8 bad value (val %x mask %x pack_key8: Final word off %d val %08x mask %08x parse_cmd argc %d %s offset %d length %d preserveclearretainparse_cmd done argc %d %s offset %d length %d bad pedit parsing while pedit (%d:%s) peditmungeIllegal pedit construct (%s) Usage: ... skbedit <[QM] [PM] [MM]> QM = queue_mapping QUEUE_MAPPING PM = priority PRIORITY MM = mark MARK QUEUE_MAPPING = device transmit queue to use PRIORITY = classID to assign to priority field MARK = firewall mark to set [NULL skbedit parameters] skbedit queue_mapping %u priority %s mark %dskbeditqueue_mappingIllegal queue_mapping Illegal priority Illegal mark Usage: nbyte(NEEDLE at OFFSET [layer LAYER]) where: NEEDLE := { string | "c-escape-sequence" } OFFSET := int LAYER := { link | network | transport | 0..%d } Example: nbyte("ababa" at 12 layer 1) NByte header size mismatch NByte payload size mismatch " at %d layer %dnbyte: missing argumentsnbyte: needle length is 0nbyte: missing argumentnbyte: invalid offset, must be numericnbyte: invalid layernbyte: illegal layer, must be in 0..%dnbyte: unknown parameternbyte: offset requiredUsage: cmp(ALIGN at OFFSET [ ATTRS ] { eq | lt | gt } VALUE) where: ALIGN := { u8 | u16 | u32 } ATTRS := [ layer LAYER ] [ mask MASK ] [ trans ] LAYER := { link | network | transport | 0..%d } Example: cmp(u16 at 3 layer 2 mask 0xff00 gt 20) CMP header size mismatch u8 u16 at %d layer %d mask 0x%x trans eq lt gt cmp: missing argumentscmp: invalid alignmentcmp: missing argumentcmp: invalid offset, must be numericcmp: invalid layercmp: illegal layer, must be in 0..%dcmp: invalid masktranseqgtltcmp: invalid valuecmp: offset and value requiredUsage: u32(ALIGN VALUE MASK at [ nexthdr+ ] OFFSET) where: ALIGN := { u8 | u16 | u32 } Example: u32(u16 0x1122 0xffff at nexthdr+4) U32 header size mismatch %08x/%08x at %s%du32: missing argumentsu32: invalid alignmentu32: missing keyu32: invalid key, must be numericu32: missing masku32: invalid mask, must be numericu32: missing "at"u32: missing offsetu32: invalid offsetu32: unexpected trailerIllegal key (>0xFF)Illegal mask (>0xFF)Illegal key (>0xFFFF)Illegal mask (>0xFFFF)u32: invalid offset alignment, must be aligned to 4.Usage: meta(OBJECT { eq | lt | gt } OBJECT) where: OBJECT := { META_ID | VALUE } META_ID := id [ shift SHIFT ] [ mask MASK ] Example: meta(nfmark gt 24) meta(indev shift 1 eq "ppp") meta(tcindex mask 0xf0 eq 0xf0) For a list of meta identifiers, use meta(list). Missing value TLV meta int type value TLV size mismatch. [unknown meta id %d] shift %d mask 0x%08xmeta int type mask TLV size mismatch Missing meta header Meta header size mismatch eq lt gt BUG: Unknown map character '%c' meta: missing arguments-------------------------------------------------------- ID Type Description -------------------------------------------------------- %s: %-16s INTVAR%-10s %s -------------------------------------------------------- meta: unknown meta id meta: missing argumentmeta: invalid shift, must be numericmeta: invalid mask, must be numericmeta: missing operandmeta: invalid operandmeta: missing rvaluelvalue and rvalue are not compatible.meta: unexpected trailerGenericiRandom value (32 bit)loadavg_1Load average in last minuteloadavg_5Load average in last 5 minutesloadavg_15Load average in last 15 minutesInterfacesivDevice the packet is onPacket attributesPriority of packetLink layer protocolpkt_typePacket type (uni|multi|broad|...)castpkt_lenLength of packetdata_lenLength of data in packetmac_lenLength of link layer headerNetfilternf_markNetfilter markfwmarkAlias for nf_markTraffic ControlTC IndexRoutingrt_classidRouting ClassID (cls_route)rt_iifIncoming interface indexvlanVlan tagSocketssk_familyAddress familysk_stateStatesk_reuseReuse Flagsk_bind_ifBound interfacesk_refcntReference countersk_shutdownShutdown masksk_protoProtocolsk_typeTypesk_rcvbufReceive buffer sizesk_rmemRMEMsk_wmemWMEMsk_omemOMEMsk_wmem_queueWMEM queuesk_snd_queueSend queue lengthsk_rcv_queueReceive queue lengthsk_err_queueError queue lengthsk_fwd_allocForward allocationssk_sndbufSend buffer size$4DTTry `%s -h' or '%s --help' for more information. tc-ipt%s v%s: 0.1Perhaps iptables or your kernel needs to be upgraded. get_target_name%s/libxt_%s.so%s/libipt_%s.so%d.%d.%d.%diptables: calloc failedIPTABLES_LIB_DIR/usr/local/lib/iptables[NULL ipt table name ] assuming mangle tablename: %s [NULL ipt hook name ] hook: %s [NULL ipt target parameters ] %s error target failed to find target %s [NULL ipt target index ] index %d ref %d bind %dbad arguements to ipt %d vs %d j: ipt Parser BAD!! (%s) tablename: %s hook: %s mangle target: index %d NF_IP_PRE_ROUTINGNF_IP_LOCAL_INNF_IP_FORWARDNF_IP_LOCAL_OUTNF_IP_POST_ROUTINGjumpif%dif%uCannot open netlink socketSO_SNDBUFSO_RCVBUFCannot bind netlink socketCannot getsocknameWrong address length %d Wrong address family %d ERROR truncated netlink receive error %s (%d) EOF on netlink RTNETLINK answersMessage truncated !!!Remnant of size %d Cannot talk to rtnetlinksender address length == %d Truncated message !!!malformed message: len=%d Unexpected reply!!! Sender address length == %d rtnl_from_file: fread!!!malformed message: len=%d @%lu rtnl-from_file: truncated message addattr_l ERROR: message exceeded bound of %d addraw_l ERROR: message exceeded bound of %d rta_addattr32: Error! max allowed bound %d exceeded rta_addattr_l: Error! max allowed bound %d exceeded !!!Deficit %d, rta_len=%d Error: "%s" may be inet address, but it is not allowed in this context. Error: an inet address is expected rather than "%s". Error: "%s" may be inet prefix, but it is not allowed in this context. Error: an inet prefix is expected rather than "%s". Error: an IP address is expected rather than "%s" Command line is not complete. Try option "help" Error: argument "%s" is required Error: argument "%s" is wrong: %s Error: duplicate "%s": "%s" is the second value. Error: either "%s" is duplicate, or "%s" is a garbage. HZPROC_NET_PSCHEDPROC_ROOT%s/net/psched/proc/net/psched%*08x%*08x%08x%08xnsnsecnsecsjhzjiffiesTimestamp: %s %lu usec Out of memory \ Too many arguments to command 0x%x %s 0x%x %s #%d %s %d %s #Database %s is corrupted at %s /etc/iproute2/rt_protosnowherehostsite/etc/iproute2/rt_scopes/etc/iproute2/rt_realms/etc/iproute2/rt_dsfield/etc/iproute2/rt_tables0x%02xglobalkernelbootstaticgatedramrtzebrabirddnroutedxorpntkdhcpmainlocal[%d]loopx25arpbpqieeepupieeepupatdecdna_dldna_rcdna_rtlatdiagcustscararpatalkaarpipxipv6ppp_discppp_sesatmmpoaatmfate802_3ax25all802_2snapddcmpwan_pppppp_mplocaltalkcanppptalktr_802_2mobitexcontrolirdaeconettipcaoe802.1Qipv4ipproto-%d%08x%08x%08xUsage: ... stab [ mtu BYTES ] [ tsize SLOTS ] [ mpu BYTES ] [ overhead BYTES ] [ linklayer TYPE ] ... mtu : max packet size we create rate map for {2047} tsize : how many slots should size table have {512} mpu : minimum packet size used in rate computations overhead : per-packet size overhead used in rate computations linklayer : adapting to a linklayer e.g. atm Example: ... stab overhead 20 linklayer atm invalid mtuinvalid mpuinvalid overheadtsizeinvalid table sizeinvalid linklayerlinklayer %s overhead %d mpu %u mtu %u tsize %u *< `c  `` ```$`(`0`85<DL7T݆Xc`dlLt|  ̤Фؤʈ 3Jr ''oh8  $*ho oo$)policep)%J~}K~}K~}#dLNh#Q0pWȦ$ȦWXX[rsvprsvp6u32route Dfw basicDflowpcgroup$#o(*P'*Ds.,tcindex87$<< x I >`HD>}JLJOL}JLJOL@~X\YYdW\Ygact\Zmirredtg`natkipedit{oskbeditipip6icmp8tcp@udpHnbyte`Pcmpp`u3208uu@D\@h@@ܕuu#uu*@ +@,@@L t@| @ @ܖuu @ @uu n@,8uu@@Lh@p.@uu@ė@Зؗ@ @,@8H@T`@hp@|@@@@Иܘ@@(@8 L@\!p@|meta84|hj03iptl-pxh.xGGGnȣУ??A0aeabi&7-A A   tc3^.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.ARM.attributes.gnu_debuglink 44HH !ohh+ 8832;oFZHo J`W Jh` J iM dMoQ0Lu{p' ''''''''p$)$)$*$*++GG8pG1GG