Q\?TTqTb(U!UUUUUVV 2V ?VLVlVV V VV V%V$V%W8WLWTWYWCbWW)W2W X 8XFX OX YXcXxX X XXXXXXOY hYuY|YYYYYYYYZZ6Z?ZXZwZZZZ4Z [[![0[7[?[ G[S['j[[[ [ [[ [ [ [+[ \f%\\ \ \\\\\\] ]@]#V]$z]] ]]]]]#^(^C^\^u^^/^&^,^#*_#N_r__+_*__# `/`F`^`Fw`)`)`aa.aCa ]aga aaaaab"b#?b cb=mbJb>bD5czcfcc d. d@Od@dFd"e;eDeWe+peeeeeff/f?fOfWf_f of |fff"f"f!f g5gTgngggg-g,g $h$Ehjh5h4hh h ii)$i%Niti"iiiiii'ij2jOjkjpj'j'jjj j kk6kVk^kykkkkkk#kk ll70lhl.ylllllm"m ?m`mrm mm(mm%mn(nCn*bn nn'n3n@o*Ro}oo/oo'op:pVp4tppp pp3p$q-q?q,Wqq q q q qqqqqq r#r 7r'Xr$rrrrr s(s0sDs[s&ms'sss%st1t$8t2]tttttt)tu,uBac 9?/F]vvԱKӲ[TQ;´ƴɴ̴ϴҴմش۴޴   #&),/258;>BEHKNQTWZ]`cfilorux{~µŵȵ˵ϵҵյ{&)̸*B Y fs ˹չ30*,[M 2"=U( ɻһ ڻ "+6bhT%+>M^sǽ޽6HZ5nþؾ߾% 2; Q [g p z + qɿ;C KUhz#(!G iv% ,M-`$*!"#=*E*p.!H<,,)1Hgn$# 'L3S=?Rli!0DE@B#2;N-g&6FMU f s~""!(Gd&& ,&S?j? 2&#Y }%-0"F&i!!  +8Sqx  +:L^=p1$7\p! &#%8^v"- ' 64Ck.!2E+_G&6 S]5y,$ 4 A N [iy}#" &$!Faz,15 g 1$) :3n,,A]o (-"P&f+0$2,7_)  ?.S!$,?(]-./N`}', )BX#s6 )8JYb ku  !,Nn".)Ku   )5')]5)5)5G)}5)5)=5g)5%#6 Mn   4%U{  *#,PYk~%&6R'Y/$%>Pahpu%|+:Tj{3$)X4*=P!n!, 08i # OIb } S#ka{% >L[(q(.7 W#x!4 +,@m".*B^u-,2 4Hc$l K.)&(P*y.*/ .95N &*Q%q%< E@f00 )!"Knu .1#7T)p$,boqIJ+avYp. -J"` :M# )7 =^o !*=1O7* . @K_!{.,.(C,Z1&! &/ Vw   h'.+ !3 H R \h}.2J`w!   . > ^ q 2      %  ? +` &          + G  \  g u  ( +   " #8 \ k 6{  +  C 5K        ( $*,.W052#Vk$!D!/!Q%s!&$;'!c "6 Fg} * 8T!t&.2J1}1#AH MZcw&.%*T  !3Bdv)<X>iD -F U `PWio2f{-DjA^>ADHKORUY\_bfilpswz}  #&),/258;?BEHKNQTX[^adgjmpsvy|O5dY6 bH:~Q#sn-qWa^:j(]va'V]eui C[bj{Tp0eY2'~8mn!t@-i%fhU;5JPzDsEVU># JEPm+&pG*HLynt(C~*vI,K x7>[{35TDsdm"/'3R"y }fKO0\p;W1 4 N$M=l|ZojAY+)$usq}0+cF;FZ]OqAT*,I$82r6`9 2N\kX!E]JtB^`B%o_XoIR3K}ZS68y{lBggLj!=.{XWuc ":h7?z??/ _U<;G@)3 !C>Nca`A-c27v% )\[O|Y9(7h_ MSfRPlEM&L4G ^(i)Kt.Q\/: 1.DBgwSk HvW%b"GuQ#4w PM<Cp&D?rry|I 4 f+m~ #AieweHV$JqwXadl  ',|z1FU5QT8/6S_@Ro-Z[>`1}= ,Nxx*hFxr9Ldb9^z<0k&gn=<k.@ V<Less/Greater><Less/Greater> chooses 3rd level, acts as onetime lock when pressed together with another 3rd-level-chooser<Less/Greater> chooses 5th level, locks when pressed together with another 5th-level-chooser3rd level of <Less/Greater>3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APL keyboard symbolsATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer LaptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAllow breaking grabs with keyboard actions (warning: security risk)Alt and Meta are on Alt keysAlt is mapped to Right Win, Super to MenuAlt is mapped to Win keys (and the usual Alt keys)Alt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny Alt keyAny Win keyAny Win key (while pressed)AppleApple Aluminium Keyboard (ANSI)Apple Aluminium Keyboard (ISO)Apple Aluminium Keyboard (JIS)Apple Aluminium Keyboard: emulate PC keys (Print, Scroll Lock, Pause, Num Lock)Apple LaptopArabicArabic (Buckwalter)Arabic (Morocco)Arabic (Pakistan)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (azerty)Arabic (azerty/digits)Arabic (digits)Arabic (qwerty)Arabic (qwerty/digits)ArmenianArmenian (OLPC phonetic)Armenian (alternative eastern)Armenian (alternative phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus LaptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless Internet KeyboardBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash chooses 3rd level, acts as onetime lock when pressed together with another 3rd-level-chooserBambaraBashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (ISO alternate)Belgian (Sun Type 6/7)Belgian (Sun dead keys)Belgian (Wang model 724 azerty)Belgian (alternative)Belgian (alternative, Latin-9 only)Belgian (alternative, Sun dead keys)Belgian (eliminate dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800BengaliBengali (India)Bengali (India, Baishakhi Inscript)Bengali (India, Baishakhi)Bengali (India, Bornona)Bengali (India, Probhat)Bengali (India, Uni Gitanjali)Bengali (Probhat)Berber (Morocco, Tifinagh alternative phonetic)Berber (Morocco, Tifinagh alternative)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US keyboard with Bosnian digraphs)Bosnian (US keyboard with Bosnian letters)Bosnian (use Bosnian digraphs)Bosnian (use guillemets for quotes)Both Alt keys togetherBoth Ctrl keys togetherBoth Shift keys togetherBoth Shift keys together activate Caps Lock, one Shift key deactivatesBoth Shift keys together toggle Caps LockBoth Shift keys together toggle ShiftLockBrailleBraille (left hand)Braille (right hand)Brother Internet KeyboardBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseCameroon Multilingual (Dvorak)Cameroon Multilingual (azerty)Cameroon Multilingual (qwerty)Canadian MultilingualCanadian Multilingual (first part)Canadian Multilingual (second part)Caps LockCaps Lock (to first layout), Shift+Caps Lock (to last layout)Caps Lock (while pressed), Alt+Caps Lock does the original capslock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift doesn't affect Caps LockCaps Lock as CtrlCaps Lock chooses 3rd level, acts as onetime lock when pressed together with another 3rd-level-chooserCaps Lock is disabledCaps Lock key behaviorCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift doesn't affect Caps LockCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alternate option)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony Internet KeyboardChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Easy Access KeyboardCompaq Internet Keyboard (13 keys)Compaq Internet Keyboard (18 keys)Compaq Internet Keyboard (7 keys)Compaq iPaq KeyboardCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US keyboard with Croatian digraphs)Croatian (US keyboard with Croatian letters)Croatian (use Croatian digraphs)Croatian (use guillemets for quotes)Ctrl + Alt + BackspaceCtrl is mapped to Alt keys, Alt is mapped to Win keysCtrl is mapped to Win keys (and the usual Ctrl keys)Ctrl key positionCtrl+ShiftCzechCzech (Sun Type 6/7)Czech (UCW layout, accented letters only)Czech (US Dvorak with CZ UCW support)Czech (qwerty)Czech (qwerty, extended Backslash)Czech (with <\|> key)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, eliminate dead keys)Danish (Sun Type 6/7)Danish (eliminate dead keys)Default numeric keypad keysDellDell 101-key PCDell Laptop/notebook Inspiron 6xxx/8xxxDell Laptop/notebook Precision M seriesDell Latitude series laptopDell Precision M65Dell SK-8125Dell SK-8135Dell USB Multimedia KeyboardDexxa Wireless Desktop KeyboardDhivehiDiamond 9801 / 9802 seriesDutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (Sun dead keys)Dutch (standard)DzongkhaEnable extra typographic charactersEnglish (Cameroon)English (Canada)English (Colemak)English (Dvorak alternative international no dead keys)English (Dvorak)English (Dvorak, international with dead keys)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with RupeeSign)English (Macintosh)English (Mali, US Macintosh)English (Mali, US international)English (Nigeria)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak with UK punctuation)English (UK, Dvorak)English (UK, Macintosh international)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended WinKeys)English (UK, international with dead keys)English (US)English (US, Sun Type 6/7)English (US, alternative international)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, international with dead keys)English (US, with euro on 5)English (Workman)English (Workman, international with dead keys)English (classic Dvorak)English (international AltGr dead keys)English (left handed Dvorak)English (programmer Dvorak)English (right handed Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US keyboard with Estonian letters)Estonian (eliminate dead keys)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (eliminate dead keys)FilipinoFilipino (Capewell-Dvorak Baybayin)Filipino (Capewell-Dvorak Latin)Filipino (Capewell-QWERF 2006 Baybayin)Filipino (Capewell-QWERF 2006 Latin)Filipino (Colemak Baybayin)Filipino (Colemak Latin)Filipino (Dvorak Baybayin)Filipino (Dvorak Latin)Filipino (QWERTY Baybayin)FinnishFinnish (Macintosh)Finnish (Sun Type 6/7)Finnish (classic)Finnish (classic, eliminate dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alternative)French (Morocco)French (Sun Type 6/7)French (Sun dead keys)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, Sun dead keys)French (Switzerland, eliminate dead keys)French (alternative)French (alternative, Latin-9 only)French (alternative, Sun dead keys)French (alternative, eliminate dead keys)French (eliminate dead keys)French (legacy, alternative)French (legacy, alternative, Sun dead keys)French (legacy, alternative, eliminate dead keys)Fujitsu-Siemens Computers AMILO laptopFulaGaGeneric 101-key PCGeneric 102-key (Intl) PCGeneric 104-key PCGeneric 105-key (Intl) PCGenius Comfy KB-12eGenius Comfy KB-16M / Genius MM Keyboard KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Austria)German (Austria, Macintosh)German (Austria, Sun dead keys)German (Austria, eliminate dead keys)German (Dvorak)German (Macintosh)German (Macintosh, eliminate dead keys)German (Neo 2)German (Sun Type 6/7)German (Sun dead keys)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, Sun dead keys)German (Switzerland, eliminate dead keys)German (Switzerland, legacy)German (T3)German (US keyboard with German letters)German (dead acute)German (dead grave acute)German (eliminate dead keys)German (legacy)German (qwerty)German (with Hungarian letters and no dead keys)GreekGreek (Sun Type 6/7)Greek (eliminate dead keys)Greek (extended)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHappy Hacking KeyboardHappy Hacking Keyboard for MacHausaHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard Internet KeyboardHewlett-Packard Mini 110 NotebookHewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 5xxHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT11xxHewlett-Packard Pavilion dv5Hewlett-Packard SK-250x Multimedia KeyboardHewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/qwerty/comma/dead keys)Hungarian (101/qwerty/comma/eliminate dead keys)Hungarian (101/qwerty/dot/dead keys)Hungarian (101/qwerty/dot/eliminate dead keys)Hungarian (101/qwertz/comma/dead keys)Hungarian (101/qwertz/comma/eliminate dead keys)Hungarian (101/qwertz/dot/dead keys)Hungarian (101/qwertz/dot/eliminate dead keys)Hungarian (102/qwerty/comma/dead keys)Hungarian (102/qwerty/comma/eliminate dead keys)Hungarian (102/qwerty/dot/dead keys)Hungarian (102/qwerty/dot/eliminate dead keys)Hungarian (102/qwertz/comma/dead keys)Hungarian (102/qwertz/comma/eliminate dead keys)Hungarian (102/qwertz/dot/dead keys)Hungarian (102/qwertz/dot/eliminate dead keys)Hungarian (eliminate dead keys)Hungarian (qwerty)Hungarian (standard)Hyper is mapped to Win-keysIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Sun dead keys)Icelandic (eliminate dead keys)IgboIndianInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US keyboard with Italian letters)Italian (eliminate dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98xx Series)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (with Russian)Key sequence to kill the X serverKey to choose 3rd levelKey to choose 5th levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Kurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)Laptop/notebook Compaq (eg. Armada) Laptop KeyboardLaptop/notebook Compaq (eg. Presario) Internet KeyboardLaptop/notebook eMachines m68xxLatvianLatvian (F variant)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe variant)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde variant)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt+Left ShiftLeft CtrlLeft Ctrl (to first layout), Right Ctrl (to last layout)Left Ctrl as MetaLeft Ctrl+Left ShiftLeft ShiftLeft WinLeft Win (to first layout), Right Win/Menu (to last layout)Left Win (while pressed)Left Win chooses 5th level, locks when pressed together with another 5th-level-chooserLeftCtrl+LeftWin (to first layout), RightCtrl+Menu (to second layout)LegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US keyboard with Lithuanian letters)Lithuanian (standard)Logitech Access KeyboardLogitech Cordless DesktopLogitech Cordless Desktop (alternate option)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (alternate option 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech Generic KeyboardLogitech Internet 350 KeyboardLogitech Internet KeyboardLogitech Internet Navigator KeyboardLogitech Media Elite KeyboardLogitech Ultra-X Cordless Media Desktop KeyboardLogitech Ultra-X KeyboardLogitech diNovo Edge KeyboardLogitech diNovo KeyboardLogitech iTouchLogitech iTouch Cordless Keyboard (model Y-RB6)Logitech iTouch Internet Navigator Keyboard SELogitech iTouch Internet Navigator Keyboard SE (USB)Lower SorbianLower Sorbian (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (Intl)MacedonianMacedonian (eliminate dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional CtrlMake Caps Lock an additional ESCMake Caps Lock an additional HyperMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional ESCMalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript with Rupee Sign)MalteseMaltese (with US layout)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-Access KeyboardMemorex MX2750MenuMenu as Right CtrlMeta is mapped to Left WinMeta is mapped to Win keysMicrosoft Comfort Curve Keyboard 2000Microsoft Internet KeyboardMicrosoft Internet Keyboard Pro, SwedishMicrosoft NaturalMicrosoft Natural Keyboard EliteMicrosoft Natural Keyboard Pro / Microsoft Internet Keyboard ProMicrosoft Natural Keyboard Pro OEMMicrosoft Natural Keyboard Pro USB / Microsoft Internet Keyboard ProMicrosoft Natural Wireless Ergonomic Keyboard 4000Microsoft Natural Wireless Ergonomic Keyboard 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia Keyboard 1.0AMiscellaneous compatibility optionsMoldavianMoldavian (Gagauz)MongolianMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, Z and ZHE swapped)Montenegrin (Latin Unicode qwerty)Montenegrin (Latin Unicode)Montenegrin (Latin qwerty)Montenegrin (Latin with guillemets)Multilingual (Canada, Sun Type 6/7)NICOLA-F style BackspaceNepaliNon-breakable space character at fourth levelNon-breakable space character at fourth level, thin non-breakable space character at sixth levelNon-breakable space character at fourth level, thin non-breakable space character at sixth level (via Ctrl+Shift)Non-breakable space character at second levelNon-breakable space character at third levelNon-breakable space character at third level, nothing at fourth levelNon-breakable space character at third level, thin non-breakable space character at fourth levelNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, eliminate dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, eliminate dead keys)Norwegian (Sun Type 6/7)Norwegian (eliminate dead keys)Num LockNumeric keypad delete key behaviourNumeric keypad keys always enter digits (as in Mac OS)OLPCOccitanOghamOgham (IS434)OriyaOrtek MCK-800 MM/Internet keyboardOssetian (Georgia)Ossetian (WinKeys)Ossetian (legacy)PC-98xx SeriesPannonian Rusyn (homophonic)PashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian Keypad)PolishPolish (Colemak)Polish (Dvorak)Polish (Dvorak, Polish quotes on key 1)Polish (Dvorak, Polish quotes on quotemark key)Polish (Sun Type 6/7)Polish (international with dead keys)Polish (legacy)Polish (programmer Dvorak)Polish (qwertz)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, eliminate dead keys)Portuguese (Brazil, nativo for Esperanto)Portuguese (Brazil, nativo for US keyboards)Portuguese (Brazil, nativo)Portuguese (Macintosh)Portuguese (Macintosh, Sun dead keys)Portuguese (Macintosh, eliminate dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (Sun dead keys)Portuguese (eliminate dead keys)Position of Compose keyPropeller Voyager (KTEZ-1000)PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt as Right CtrlRight Alt chooses 5th level, locks when pressed together with another 5th-level-chooserRight Alt key never chooses 3rd levelRight Alt, Shift+Right Alt key is ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level, locks when pressed together with another 5th-level-chooserRomanianRomanian (Germany)Romanian (Germany, eliminate dead keys)Romanian (Sun Type 6/7)Romanian (WinKeys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, eliminate dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic WinKeys)Russian (phonetic)Russian (typewriter)Russian (typewriter, legacy)Russian (with Ukrainian-Belorussian layout)SILVERCREST Multimedia Wireless KeyboardSK-1300SK-2500SK-6200SK-7100SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, Z and ZHE swapped)Serbian (Latin Unicode qwerty)Serbian (Latin Unicode)Serbian (Latin qwerty)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + NumLock toggles PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift with numeric keypad keys works as in MS WindowsShift+Caps LockSindhiSinhala (phonetic)SlovakSlovak (Sun Type 6/7)Slovak (extended Backslash)Slovak (qwerty)Slovak (qwerty, extended Backslash)SlovenianSlovenian (US keyboard with Slovenian letters)Slovenian (use guillemets for quotes)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Sun dead keys)Spanish (Latin American, eliminate dead keys)Spanish (Latin American, include dead tilde)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Sun dead keys)Spanish (eliminate dead keys)Spanish (include dead tilde)Special keys (Ctrl+Alt+<key>) handled in a serverSun Key compatibilitySun Type 6 (Japanese layout)Sun Type 6 USB (Japanese layout)Sun Type 6 USB (Unix layout)Sun Type 6/7 USBSun Type 6/7 USB (European layout)Sun Type 7 USBSun Type 7 USB (European layout)Sun Type 7 USB (Japanese layout) / Japanese 106-keySun Type 7 USB (Unix layout)Super Power Multimedia KeyboardSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwedishSwedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (eliminate dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook (tablet PC)SyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)TamilTamil (Sri Lanka, TAB Typewriter)Tamil (Sri Lanka, Unicode)Tamil (TAB typewriter)Tamil (TSCII typewriter)Tamil (Unicode)Tamil (keyboard with numerals)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a Qwerty layoutToshiba Satellite S3000Trust Direct Access KeyboardTrust SlimlineTrust Wireless Keyboard ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Sun Type 6/7)Turkish (Sun dead keys)Turkish (international with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUkrainianUkrainian (Sun Type 6/7)Ukrainian (WinKeys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (WinKeys)Urdu (alternative phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breakable space characterUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseViewSonic KU-306 Internet KeyboardWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Winbook Model XP5WolofYahoo! Internet KeyboardYakutYorubaZero-width non-joiner character at second levelZero-width non-joiner character at second level, non-breakable space character at third levelZero-width non-joiner character at second level, non-breakable space character at third level, nothing at fourth levelZero-width non-joiner character at second level, non-breakable space character at third level, thin non-breakable space at fourth levelZero-width non-joiner character at second level, non-breakable space character at third level, zero-width joiner at fourth levelZero-width non-joiner character at second level, zero-width joiner character at third levelZero-width non-joiner character at second level, zero-width joiner character at third level, non-breakable space character at fourth levelZero-width non-joiner character at third level, zero-width joiner at fourth levelakamaplaravnazbeberbgbmbnbrlbsbychrcmcrhcsdadedvdzeeeneoesetfafffifofrgaagaggrguhahehihrhuhyieigikeinisitjakakikkkmknkokukutloltlvmdmimkmlmnmrmtmynenlnoorpaphplpsptrorusasdshssiskslsqsrsvswsyctatetgthtktntrukuruzviwoxsyyozhProject-Id-Version: xkeyboard-config-2.9.91 Report-Msgid-Bugs-To: svu@users.sourceforge.net POT-Creation-Date: 2013-09-14 14:41+0200 PO-Revision-Date: 2013-09-14 17:58+0200 Last-Translator: Josep Ma. Ferrer Language-Team: Catalan Language: ca MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: Lokalize 1.4 Plural-Forms: nplurals=2; plural=n != 1; <Més petit/Més gran><Més petit/Més gran> selecciona el nivell 3r, bloqueja un cop en prémer conjuntament amb un altre selector de nivell 3r<Més petit/Més gran> selecciona el nivell 5è, bloqueja en prémer conjuntament amb un altre selector de nivell 5è3r nivell de <Més petit/Més gran>3r nivell de Bloq Maj3r nivell de Ctrl esquerra3r nivell de Win esquerra3r nivell de Menú3r nivell de Ctrl dreta3r nivell de Win dretaA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23Símbols de teclat APLEstil ATM/telèfonAcer AirKey VAcer C300Acer Ferrari 4000Portàtil AcerAfegeix el comportament estàndard a la tecla MenúS'afegeix les lletres amb diacrític l'esperantoS'afegeix el signe de moneda a certes teclesAdvance Scorpius KIAfganèsAkanAlbanèsPermetre trencar la captura amb accions del teclat (avís: risc de seguretat)Alt i Meta són a les tecles AltAlt s'assigna a la tecla Win dreta i Super a MenúAlt s'assigna a les tecles Win (i a les tecles Alt habituals)Alt està intercanviada amb la tecla WinAlt+Bloq MajAlt+CtrlAlt+MajAlt+EspaiComportament de la tecla Alt/WinAmhàricQualsevol tecla AltQualsevol tecla WinQualsevol tecla Win (mentre estan premudes)AppleTeclat Apple Aluminium (ANSI)Teclat Apple Aluminium (ISO)Teclat Apple Aluminium (JIS)Teclat Apple Aluminium: emula les tecles del PC (Impr, Bloq Despl, Pausa, Bloq Núm)Portàtil AppleÀrabÀrab (Buckwalter)Àrab (Marroc)Àrab (Pakistan)Àrab (Sun Type 6/7)Àrab (Síria)Àrab (azerty)Àrab (azerty/dígits)Àrab (dígits)Àrab (qwerty)Àrab (qwerty/dígits)ArmeniArmeni (fonètic OLPC)Armeni (oriental alternatiu)Armeni (fonètic alternatiu)Armeni (oriental)Armeni (fonètic)Armeni (occidental)Asturià (Espanya, amb H punt baix i L amb punt baix)Portàtil AsusA baix esquerraA l'esquerra d'«A»AtsinaAvatimeAvèsticÀzeriÀzeri (ciríl·lic)Teclat Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarra inversaBarra inversa selecciona el nivell 3r, bloqueja un cop en prémer conjuntament amb un altre selector de 3r nivellBambaraBaixkirBielorúsBielorús (llatí)Bielorús (antic)BelgaBelga (alternatiu ISO)Belga (Sun Type 6/7)Belga (tecles mortes de Sun)Belga (Wang model 724 azerty)Belga (alternatiu)Belga (alternatiu, només llatí-9)Belga (alternatiu, tecles mortes de Sun)Belga (elimina les tecles mortes)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800BengalíBengalí (Índia)Bengalí (Índia, Inscript Baishakhi)Bengalí (Índia, Baishakhi)Bengalí (Índia, Bornona)Bengalí (Índia, Probhat)Bengalí (Índia, Uni Gitanjali)Bengalí (Probhat)Berber (Marroc, Tifinagh fonètic alternatiu)Berber (Marroc, Tifinagh alternatiu)Berber (Marroc, Tifinagh fonètic ampliat)Berber (Marroc, Tifinagh ampliat)Berber (Marroc, Tifinagh fonètic)Berber (Marroc, Tifinagh)BosniàBosnià (teclat EUA amb dígrafs bosnians)Bosnià (teclat EUA amb lletres bosnianes)Bosnià (usa dígrafs bosnians)Bosnià (usa cometes angulars per les cometes)Les dues tecles Alt juntesLes dues tecles Ctrl juntesLes dues tecles Maj juntesLes dues tecles Maj juntes commuten Bloq Maj, una tecla Maj ho desactivaLes dues tecles Maj juntes commuten Bloq MajLes dues tecles Maj juntes commuten Bloq MajBrailleBraille (ma esquerra)Braille (ma dretà)Teclat Brother InternetBúlgarBúlgar (fonètic nou)Búlgar (fonètic tradicional)BirmàCamerun multilingüe (dvorak)Camerun multilingüe (azerty)Camerun multilingüe (qwerty)Canadenc multilingüeCanadenc multilingüe (primera part)Canadenc multilingüe (segona part)Bloq MajúsBloq Maj (a la primera disposició), Maj+Bloq Maj (a la darrera disposició)Bloq Maj (mentre està premuda), Alt+Bloq Maj efectua l'acció de Bloq Maj originalBloq Maj actua com a Maj amb bloqueig; Maj «pausa» Bloq MajBloq Maj actua com a Maj amb bloqueig; Maj no afecta a Bloq MajBloq Majús com a CtrlBloq Maj selecciona el nivell 3r, bloqueja un cop en prémer conjuntament amb un altre selector de nivell 3rBloq Maj està deshabilitatComportament de la tecla Bloq MajBloq Maj commuta Maj (afecta a totes les tecles)Bloq Maj commuta les majúscules normals dels caràcters alfabèticsBloq Maj usa internament les majúscules; Maj «pausa» Bloq MajBloq Maj usa internament les majúscules; Maj no afecta a Bloq MajCatalà (Espanya, L amb punt volat)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (opció alternativa)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressTeclat Chicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420XinèsChuvashChuvash (llatí)Classmate PCCloGaelachCoeur d'Alene SalishTeclat Compaq Easy AccessTeclat Compaq Internet (13 tecles)Teclat Compaq Internet (18 tecles)Teclat Compaq Internet (7 tecles)Teclat Compaq iPaqCreative Desktop Wireless 7000Tàtar de Crimea (Dobruja Q)Tàtar de Crimea (Turc Alt-Q)Tàtar de Crimea (Turc F)Tàtar de Crimea (Turc Q)CroatCroat (teclat EUA amb dígrafs croats)Croat (teclat EUA amb lletres croates)Croat (usa dígrafs croats)Croat (usa cometes angulars per les cometes)Ctrl + Alt + RetrocésCtrl s'assigna a les tecles Alt, Alt s'assigna a les tecles WinCtrl s'assigna a les tecles Win (i a les tecles Ctrl habituals)Posició de la tecla CtrlCtrl+MajTxecTxec (Sun Type 6/7)Txec (disposició UCW, només lletres accentuades)Txec (dvorak EUA que permet UCW CZ)Txec (qwerty)Txec (qwerty, barra inversa ampliada)Txec (amb la tecla <\|>)DTK2000DanèsDanès (dvorak)Danès (Macintosh)Danès (Macintosh, elimina les tecles mortes)Danès (Sun Type 6/7)Danès (elimina les tecles mortes)Tecles del teclat numèric per defecteDellDell PC 101 teclesPortàtil Dell Inspiron 6xxx/8xxxPortàtil Dell sèrie Precision MPortàtil Dell sèrie LatitudeDell Precision M65Dell SK-8125Dell SK-8135Teclat Dell USB MultimediaTeclat Dexxa Wireless DesktopDiveíDiamond sèries 9801 / 9802HolandèsHolandès (Macintosh)Holandès (Sun Type 6/7)Holandès (tecles mortes de Sun)Holandès (estàndard)DzongkhaHabilita els caràcters tipogràfics extresAnglès (Camerun)Anglès (Canadà)Anglès (Colemak)Anglès (dvorak internacional alternatiu sense tecles mortes)Anglès (dvorak)Anglès (dvorak, internacional amb tecles mortes)Anglès (Ghana)Anglès (Ghana, GILLBT)Anglès (Ghana, multilingüe)Anglès (Índia, amb signe de rupia)Anglès (Macintosh)Anglès (Mali, Macintosh EUA)Anglès (Mali, internacional EUA)Anglès (Nigèria)Anglès (Sud-àfrica)Anglès (RU)Anglès (RU, Colemak)Anglès (RU, dvorak amb puntuació RU)Anglès (RU, dvorak)Anglès (RU, Macintosh internacional)Anglès (RU, Macintosh)Anglès (RU, Sun Type 6/7)Anglès (RU, tecles Win ampliades)Anglès (RU, internacional amb tecles mortes)Anglès (EUA)Anglès (EUA, Sun Type 6/7)Anglès (EUA, internacional alternatiu)Anglès (EUA, combinació internacional Unicode AltGr)Anglès (EUA, combinació internacional Unicode AltGr, alternativa)Anglès (EUA, internacional amb tecles mortes)Anglès (EUA, amb l'euro en el 5)Anglès (Workman)Anglès (Workman, internacional amb tecles mortes)Anglès (dvorak clàssic)Anglès (internacional tecles mortes AltGr)Anglès (dvorak esquerrà)Anglès (dvorak de programador)Anglès (dvorak dretà)Anglès (les tecles de multiplicació/divisió commuten la disposició)Ennyah DKB-1008Retorn en el teclat numèricEsperantoEsperanto (Portugal, natiu)Esperanto (punt i coma i cometa desplaçats, obsolet)EstoniàEstonià (dvorak)Estonià (Sun Type 6/7)Estonià (teclat EUA amb lletres estonianes)Estonià (elimina les tecles mortes)Euro en el 2Euro en el 4Euro en el 5Euro en la E Everex STEPnoteEweFL90FeroèsFeroès (elimina les tecles mortes)FilipíFilipí (Capewell-dvorak Baybayin)Filipí (Capewell-dvorak llatí)Filipí (Capewell-QWERF 2006 Baybayin)Filipí (Capewell-QWERF 2006 llatí)Filipí (Colemak Baybayin)Filipí (Colemak llatí)Filipí (dvorak Baybayin)Filipí (dvorak llatí)Filipí (QWERTY Baybayin)FinèsFinès (Macintosh)Finès (Sun Type 6/7)Finès (clàssic)Finès (clàssic, elimina les tecles mortes)Tecla de quatre nivells amb separadors abstractesTecla de quatre nivells amb comaTecla de quatre nivells amb puntTecla de quatre nivells amb punt, només llatí-9Tecla de quatre nivells amb momayyezFrancèsFrancès (Bepo, ergonòmic, tipus dvorak)Francès (Bepo, ergonòmic, tipus dvorak, només llatí-9)Francès (Bretó)Francès (Camerun)Francès (Canadà)Francès (Canadà, dvorak)Francès (Canadà, antic)Francès (República Democràtica del Congo)Francès (dvorak)Francès (Guinea)Francès (Macintosh)Francès (Mali, alternatiu)Francès (Marroc)Francès (Sun Type 6/7)Francès (tecles mortes de Sun)Francès (Suïssa)Francès (Suïssa, Macintosh)Francès (Suïssa, Sun Type 6/7)Francès (Suïssa, tecles mortes de Sun)Francès (Suïssa, elimina les tecles mortes)Francès (alternatiu)Francès (alternatiu, només llatí-9)Francès (alternatiu, tecles mortes de Sun)Francès (alternatiu, elimina les tecles mortes)Francès (elimina les tecles mortes)Francès (antic, alternatiu)Francès (antic, alternatiu, tecles mortes de Sun)Francès (antic, alternatiu, elimina les tecles mortes)Fujitsu-Siemens Computers AMILO portàtilFulaGaPC genèric de 101 teclesPC genèric de 102 tecles (intl)PC genèric de 104 teclesPC genèric de 105 tecles (intl)Genius Comfy KB-12eGenius Comfy KB-16M / Teclat Genius MM KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgiàGeorgià (França, AZERTY Tskapo)Georgià (Itàlia)Georgià (MESS)Georgià (ergonòmic)AlemanyAlemany (Àustria)Alemany (Àustria, Macintosh)Alemany (Àustria, tecles mortes de Sun)Alemany (Àustria, elimina les tecles mortes)Alemany (dvorak)Alemany (Macintosh)Alemany (Macintosh, elimina les tecles mortes)Alemany (Neo 2)Alemany (Sun Type 6/7)Alemany (tecles mortes de Sun)Alemany (Suïssa)Alemany (Suïssa, Macintosh)Alemany (Suïssa, Sun Type 6/7)Alemany (Suïssa, tecles mortes de Sun)Alemany (Suïssa, elimina les tecles mortes)Alemany (Suïssa, antic)Alemany (T3)Alemany (teclat US amb lletres alemanyes)Alemany (accent mort)Alemany (accent greu mort)Alemany (elimina les tecles mortes)Alemany (antic)Alemany (qwerty)Alemany (amb lletres hongareses i sense tecles mortes)GrecGrec (Sun Type 6/7)Grec (elimina les tecles mortes)Grec (ampliat)Grec (politònic)Grec (senzill)GujaratiGyrationHTC DreamTeclat Happy HackingTeclat Happy Hacking per a MacHaussaHebreuHebreu (bíblic, SIL fonètic)Hebreu (bíblic, Tiro)Hebreu (lyx)Hebreu (fonètic)Teclat Hewlett-Packard InternetHewlett-Packard Mini 110 NotebookHewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 5xxHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT11xxHewlett-Packard Pavilion dv5Teclat Hewlett-Packard SK-250x MultimediaHewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (fonètic KaGaPa)Hindi (Wx)Honeywell EuroboardTelèfon HTC DreamHongarèsHongarès (101/qwerty/coma/tecles mortes)Hongarès (101/qwerty/coma/elimina les tecles mortes)Hongarès (101/qwerty/punt/tecles mortes)Hongarès (101/qwerty/punt/elimina les tecles mortes)Hongarès (101/qwertz/coma/tecles mortes)Hongarès (101/qwertz/coma/elimina les tecles mortes)Hongarès (101/qwertz/punt/tecles mortes)Hongarès (101/qwertz/punt/elimina les tecles mortes)Hongarès (102/qwerty/coma/tecles mortes)Hongarès (102/qwerty/coma/elimina les tecles mortes)Hongarès (102/qwerty/punt/tecles mortes)Hongarès (102/qwerty/punt/elimina les tecles mortes)Hongarès (102/qwertz/coma/tecles mortes)Hongarès (102/qwertz/coma/elimina les tecles mortes)Hongarès (102/qwertz/punt/tecles mortes)Hongarès (102/qwertz/punt/elimina les tecles mortes)Hongarès (elimina les tecles mortes)Hongarès (qwerty)Hongarès (estàndard)Hyper s'assigna a les tecles WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandèsIslandès (dvorak)Islandès (Macintosh)Islandès (tecles mortes de Sun)Islandès (elimina les tecles mortes)IgboIndiInuktitutIraquiàIrlandèsIrlandès (UnicodeExpert)ItaliàItalià (IBM 142)Italià (Macintosh)Italià (Sun Type 6/7)Italià (teclat EUA amb lletres italianes)Italià (elimina les tecles mortes)JaponèsJaponès (dvorak)Japonès (Kana 86)Japonès (Kana)Japonès (Macintosh)Japonès (OADG 109A)Japonès (sèries PC-98xx)Japonès (Sun Type 6)Japonès (Sun Type 7 - Compatible PC)Japonès (Sun Type 7 - Compatible Sun)Opcions del teclat japonèsCalmucLa tecla de bloqueig Kana està blocantKannadaKannada (fonètic KaGaPa)CaixubiKazakhKazakh (amb rus)Seqüència de tecles per a matar el servidor XTecla per a seleccionar el 3r nivellTecla per a seleccionar el 5è nivellKeytronic FlexProKhmer (Cambotja)KikuyuKinesisKomiCoreàCoreà (compatible de 101/104 tecles)Coreà (Sun Type 6/7)Kurd (Iran, àrab-llatí)Kurd (Iran, F)Kurd (Iran, llatí Alt-Q)Kurd (Iran, llatí Q)Kurd (Iraq, àrab-llatí)Kurd (Iraq, F)Kurd (Iraq, llatí Alt-Q)Kurd (Iraq, llatí Q)Kurd (Síria, F)Kurd (Síria, llatí Alt-Q)Kurd (Síria, llatí Q)Kurd (Turquia, F)Kurd (Turquia, llatí Alt-Q)Kurd (Turquia, llatí Q)KutenaiKirguísKirguís (fonètic)LaosiàLaosià (disposició estàndard proposada per STEA)Teclat de portàtil Compaq (p.ex. Armada)Teclat Internet de portàtil Compaq (p.ex. Presario)Portàtil eMachines m68xxLetóLetó (variant F)Letó (Sun Type 6/7)Letó (Colemak EUA)Letó (Colemak EUA, variant amb apòstrof)Letó (dvorak EUA)Letó (dvorak EUA, variant Y)Letó (dvorak EUA, variant menys)Letó (adaptat)Letó (variant amb apòstrof)Letó (ergonòmic, ŪGJRMV)Letó (modern)Letó (dvorak de programador EUA)Letó (dvorak de programador EUA, variant Y)Letó (dvorak de programador EUA, variant menys)Letó (variant titlla)Disposició del teclat numèricAlt esquerraAlt esquerra (mentre està premuda)Alt esquerra+Maj esquerraCtrl esquerraCtrl esquerra (a la primera disposició), Ctrl dreta (a la darrera disposició)Ctrl esquerra com a MetaCtrl esquerra+Maj esquerraMaj esquerraWin esquerraWin esquerra (a la primera disposició), Win/Menú dreta (a la darrera disposició)Win esquerra (mentre està premuda)Win esquerra selecciona el nivell 5è, bloqueja en prémer conjuntament amb un altre selector de nivell 5èCtrl esquerra+Win esquerra (a la primera disposició), Ctrl dreta+Menú (a la segona disposició)AnticWang 724 anticTecla antiga amb comaTecla antiga amb puntLituàLituà (IBM LST 1205-92)Lituà (LEKP)Lituà (LEKPa)Lituà (Sun Type 6/7)Lituà (dvorak EUA amb lletres lituanes)Lituà (teclat EUA amb lletres lituanes)Lituà (estàndard)Teclat Logitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (opció alternativa)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (opció alternativa 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 amb tecles extres via G15daemonTeclat Logitech genèricTeclat Logitech Internet 350Teclat Logitech InternetTeclat Logitech Internet NavigatorTeclat Logitech Media EliteTeclat Logitech Ultra-X Cordless Media DesktopTeclat Logitech Ultra-XTeclat Logitech diNovo EdgeTeclat Logitech diNovoLogitech iTouchTeclat Logitech iTouch Cordless (model Y-RB6)Teclat Logitech iTouch Internet Navigator SETeclat Logitech iTouch Internet Navigator SE (USB)Baix sòrabBaix sòrab (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (Intl)MacedoniMacedoni (elimina les tecles mortes)MacintoshMacintosh anticManté la compatibilitat de tecles amb els codis de tecla antics de SolarisConverteix Bloq Maj en un Retrocés addicionalConverteix Bloq Maj en un Ctrl addicionalConverteix Bloq Maj en un Esc addicionalConverteix Bloq Maj en un Hyper addicionalConverteix Bloq Maj en un Bloq Núm addicionalConverteix Bloq Maj en un Super addicionalConverteix Zenkaku Hankaku en un Esc addicionalMalaiàlamMalaiàlam (Lalitha)Malaiàlam (Inscript realçat, amb el signe de rupia)MaltèsMaltès (amb disposició EUA)MaoriMarathi (fonètic KaGaPa)MariMemorex MX1998Teclat Memorex MX2500 EZ-AccessMemorex MX2750MenúMenú com a Ctrl dretaMeta s'assigna a la tecla Win esquerraMeta s'assigna a les tecles WinMicrosoft Comfort Curve Keyboard 2000Teclat Microsoft InternetMicrosoft Internet Keyboard Pro, SuecMicrosoft NaturalTeclat Microsoft Natural EliteTeclat Microsoft Natural Pro / Teclat Microsoft Internet ProTeclat Microsoft Natural Pro OEMTeclat Microsoft Natural Pro USB / Teclat Microsoft Internet ProTeclat Microsoft Natural Wireless Ergonomic 4000Teclat Microsoft Natural Wireless Ergonomic 7000Teclat Microsoft OfficeTeclat Microsoft Wireless Multimedia 1.0AOpcions de compatibilitat diversesMoldauMoldau (Gagauz)MongolMontenegríMontenegrí (ciríl·lic amb cometes angulars)Montenegrí (ciríl·lic)Montenegrí (ciríl·lic, Z i ZHE intercanviades)Montenegrí (llatí Unicode qwerty)Montenegrí (llatí Unicode)Montenegrí (llatí qwerty)Montenegrí (llatí amb cometes angulars)Multilingüe (Canadà, Sun Type 6/7)Retrocés estil NICOLA-FNepalèsCaràcter d'espai sense salt al nivell quartCaràcter d'espai sense salt al nivell quart, i un caràcter d'espai fi sense salt al nivell sisèCaràcter d'espai sense salt al nivell quart, un caràcter d'espai fi sense salt al nivell sisè (via Ctrl+Maj)La tecla d'espai produeix un caràcter d'espai sense salt al nivell segonLa tecla d'espai produeix un caràcter d'espai sense salt al nivell tercerLa tecla d'espai produeix un caràcter d'espai sense salt al nivell tercer, i res al nivell quartLa tecla d'espai produeix un caràcter d'espai sense salt al nivell tercer, i un caràcter d'espai fi sense salt al nivell quartSami Nord (Finlàndia)Sami Nord (Noruega)Sami Nord (Noruega, elimina les tecles mortes)Sami del nord (Suècia)Northgate OmniKey 101NoruecNoruec (Colemak)Noruec (dvorak)Noruec (Macintosh)Noruec (Macintosh, elimina les tecles mortes)Noruec (Sun Type 6/7)Noruec (elimina les tecles mortes)Bloq NúmComportament de la tecla de supressió del teclat numèricLes tecles del teclat numèric sempre introdueixen dígits (com en el Mac OS)OLPCOccitàOghamOgham (IS434)OriyaTeclat Ortek MCK-800 MM/InternetOsset (Geòrgia)Osset (tecles Win)Osset (antic)Sèries PC-98xxRutè Pannònic (homofònic)PaixtuPaixtu (Afganistan, OLPC)PausaPersaPersa (Afganistan, Dari OLPC)Persa (amb teclat persa)PolonèsPolonès (Colemak)Polonès (dvorak)Polonès (dvorak, cometes poloneses a la tecla 1)Polonès (dvorak, cometes poloneses a la tecla cometes)Polonès (Sun Type 6/7)Polonès (internacional amb tecles mortes)Polonès (antic)Polonès (dvorak de programador)Polonès (qwertz)PortuguèsPortuguès (Brasil)Portuguès (Brasil, dvorak)Portuguès (Brasil, Sun Type 6/7)Portuguès (Brasil, elimina les tecles mortes)Portuguès (Brasil, natiu per a l'esperanto)Portuguès (Brasil, natiu per als teclats EUA)Portuguès (Brasil, natiu)Portuguès (Macintosh)Portuguès (Macintosh, tecles mortes de Sun)Portuguès (Macintosh, elimina les tecles mortes)Portuguès (natiu per als teclats EUA)Portuguès (natiu)Portuguès (Sun Type 6/7)Portuguès (tecles mortes de Sun)Portuguès (elimina les tecles mortes)Posició de la tecla «Compose»Propeller Voyager (KTEZ-1000)ImprPantPanjabi (Gurmukhi Jhelum)Panjabi (Gurmukhi)QTronix Scorpius 98N+Alt dretaAlt dreta (mentre està premuda)Alt dreta com a Ctrl dretaAlt dreta selecciona el nivell 5è, bloqueja en prémer conjuntament amb un altre selector de nivell 5èLa tecla Alt dreta mai selecciona el 3r nivellAlt dreta, Maj+Alt dreta és la «Compose»Ctrl dretaCtrl dreta (mentre està premuda)Ctrl dreta com a Alt dretaCtrl dreta+Maj dretaMaj dretaWin dretaWin dreta (mentre està premuda)Win dreta selecciona el nivell 5è, bloqueja en prémer conjuntament amb un altre selector de nivell 5èRomanèsRomanès (Alemanya)Romanès (Alemanya, elimina les tecles mortes)Romanès (Sun Type 6/7)Romanès (tecles Win)Romanès (ce trencada)Romanès (ergonòmic Touchtype)Romanès (ce trencada estàndard)Romanès (estàndard)Rupia en el 4RusRus (DOS)Rus (Geòrgia)Rus (alemany, fonètic)Rus (Kazakhstan amb Kazakh)Rus (Macintosh)Rus (Polònia, fonètic dvorak)Rus (Sun Type 6/7)Rus (Suècia, fonètic)Rus (Suècia, fonètic, elimina les tecles mortes)Rus (EUA, fonètic)Rus (Ucraïna, estàndard RSTU)Rus (antic)Rus (fonètic tecles Win)Rus (fonètic)Rus (màquina d'escriure)Rus (màquina d'escriure, antic)Rus (amb disposició ucraïnesa-bielorussa)Teclat SILVERCREST Multimedia WirelessSK-1300SK-2500SK-6200SK-7100SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSànscrit (fonètic KaGaPa)Sanwa Supply SKB-KG3Bloq DesplSecwepemctsinPunt i coma al tercer nivellSerbiSerbi (ciríl·lic amb cometes angulars)Serbi (ciríl·lic, Z i ZHE intercanviades)Serbi (llatí Unicode qwerty)Serbi (llatí Unicode)Serbi (llatí qwerty)Serbi (llatí amb cometes angulars)Serbi (llatí)Serbi (Rússia)Serbi (combinació d'accents en lloc de tecles mortes)Serbocroat (EUA)Maj + BloqNúm commuta les tecles de cursorMaj cancel·la Bloq MajMaj no cancel·la Bloq Núm, en el seu lloc selecciona el 3r nivellMaj amb el teclat numèric funciona com al MS WindowsMaj+Bloq MajSindhiSingalès (fonètic)EslovacEslovac (Sun Type 6/7)Eslovac (barra inversa ampliada)Eslovac (qwerty)Eslovac (qwerty, barra inversa ampliada)EslovèEslovè (teclat EUA amb lletres eslovenes)Eslovè (usa cometes angulars per les cometes)EspanyolEspanyol (dvorak)Espanyol (llatinoamericà)Espanyol (llatinoamericà, tecles mortes de Sun)Espanyol (llatinoamericà, elimina les tecles mortes)Espanyol (llatinoamericà, inclou la titlla morta)Espanyol (Macintosh)Espanyol (Sun Type 6/7)Espanyol (tecles mortes de Sun)Espanyol (elimina les tecles mortes)Espanyol (inclou la titlla morta)Tecles especials (Ctrl+Alt+<tecla>) gestionades en un servidorCompatibilitat amb les tecles SunSun Type 6 (disposició japonesa)Sun Type 6 USB (disposició japonesa)Sun Type 6 USB (disposició Unix)Sun Type 6/7 USBSun Type 6/7 USB (disposició europea)Sun Type 7 USBSun Type 7 USB (disposició europea)Sun Type 7 USB (disposició japonesa) / 106 tecles japonesaSun Type 7 USB (disposició Unix)Teclat Super Power MultimediaSuahili (Kenya)Suahili (Tanzània)Intercanvia Ctrl i Bloq MajIntercanvia Esc i Bloq MajSuecSuec (dvorak)Suec (Macintosh)Suec (Sun Type 6/7)Suec (Svdvorak)Suec (elimina les tecles mortes)Idioma de signes suecCanvi a una altra disposicióSymplon PaceBook (tablet PC)SiriSiríac (fonètic)TaiwanèsTaiwanès (indígena)TadjikTadjik (antic)TàmilTàmil (Sri Lanka, tipus d'escriptura TAB)Tàmil (Sri Lanka, Unicode)Tàmil (tipus d'escriptura TAB)Tàmil (tipus d'escriptura TSCII)Tàmil (Unicode)Tàmil (teclat amb nombres)Targa Visionary 811TàtarTeluguTelugu (fonètic KaGaPa)TaiTai (Pattachote)Tai (TIS-820.2538)TibetàTibetà (amb nombres ASCII)A la tecla corresponent en una disposició ColemanA la tecla corresponent en una disposició dvorakA la tecla corresponent en una disposició qwertyToshiba Satellite S3000Teclat Trust Direct AccessTrust SlimlineTeclat Trust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Sun Type 6/7)Turc (tecles mortes de Sun)Turc (internacional amb tecles mortes)TurcmanTurcman (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)UdmurtUcraïnèsUcraïnès (Sun Type 6/7)Ucraïnès (tecles Win)Ucraïnès (homofònic)Ucraïnès (antic)Ucraïnès (fonètic)Ucraïnès (estàndard RSTU)Ucraïnès (màquina d'escriure)Addicions Unicode (fletxes i operadors matemàtics)Addicions Unicode (fletxes i operadors matemàtics; els operadors matemàtics al nivell per defecte)Unitek KB-1925Urdú (Pakistan)Urdú (Pakistan, CRULP)Urdú (Pakistan, NLA)Urdú (tecles Win)Urdú (fonètic alternatiu)Urdú (fonètic)Usa el LED del teclat per a mostrar la disposició alternativaUsa la tecla d'espai per a introduir un caràcter d'espai sense saltEspai normal en qualsevol nivellUigurUsbecUsbec (Afganistan)Usbec (Afganistan, OLPC)Usbec (llatí)VietnamitaTeclat ViewSonic KU-306 InternetTeclat numèric Wang 724 amb addicions Unicode (fletxes i operadors matemàtics)Teclat numèric Wang 724 amb addicions Unicode (fletxes i operadors matemàtics; els operadors matemàtics en el nivell per defecte)Winbook Model XP5WolofTeclat Yahoo! InternetIacutIorubaCaràcter separador d'amplada zero al nivell segonCaràcter separador d'amplada zero al nivell segon, i un caràcter d'espai sense salt al nivell tercerCaràcter separador d'amplada zero al nivell segon, un caràcter d'espai sense salt al nivell tercer, i res al nivell quartCaràcter separador d'amplada zero al nivell segon, un caràcter d'espai sense salt al nivell tercer, i un caràcter d'espai fi sense salt al nivell quartCaràcter separador d'amplada zero al nivell segon, un caràcter d'espai sense salt al nivell tercer, i un enllaç d'amplada zero al nivell quartCaràcter separador d'amplada zero al nivell segon, un caràcter d'enllaç d'amplada zero al nivell tercerCaràcter separador d'amplada zero al nivell segon, un caràcter d'enllaç d'amplada zero al nivell tercer, i un caràcter d'espai sense salt al nivell quartCaràcter separador d'amplada zero al nivell tercer, un enllaç d'amplada zero al nivell quartakamaplaravnazbeberbgbmbnbrlbsbychrcmcrhcsdadedvdzeeeneoesetfafffifofrgaagaggrguhahehihrhuhyieigikeinisitjakakikkkmknkokukutloltlvmdmimkmlmnmrmtmynenlnoorpaphplpsptrorusasdshssiskslsqsrsvswsyctatetgthtktntrukuruzviwoxsyyozh