ELF(د4D4 (p$$$88444  TTT``" " "xԵ5 5 pppDDQtdRtd" " XX/lib/ld-linux-armhf.so.3GNU GNU6.sMy-Z:Q@ MDBE4j Cֻ|WqXXyvT< T" s mB0 l x/ ; RmHDG ZrPK(} t ! f om. ] 7 NW+} jh>>-D/d z g  4D  f& Wx = cX4d  k "W  /#u T(8 E nUi~ y,S kE+ #q S    @F  z]\ ]]R_C w`%o  b#7+z JLQI V c'=kal| [l     3_ F($Q %> J>{72 Z  ! G> 7C55[ Ku p'< zi @  E M e  R8> 9z2 A g"   sZ     ^XtdJ> ZXC Y].Qh e!C` / T[cKR "I " P r&2)VE x8 I@ 8 w8 Lb ]E /d 8 0iE / libfipscheck.so.1_ITM_deregisterTMCloneTable__gmon_start___Jv_RegisterClasses_ITM_registerTMCloneTableFIPSCHECK_verifylibwrap.so.0refusesock_hostrequest_inithosts_accesslibaudit.so.1audit_openaudit_log_acct_messageaudit_closeaudit_log_user_messagelibpam.so.0pam_open_sessionpam_close_sessionpam_set_itempam_get_itempam_setcredpam_startpam_strerrorpam_acct_mgmtpam_getenvlistpam_chauthtokpam_endpam_authenticatepam_putenvlibselinux.so.1context_strgetconselinux_trans_to_raw_contextget_default_typeis_selinux_enabledsecurity_getenforcecontext_type_setsecurity_compute_avget_default_context_with_levelgetfileconsetconsetfilecongetexecconsecurity_compute_relabelmatchpathconcontext_role_setfreeconsetexecconcontext_range_getget_default_contextgetcon_rawcontext_freesetfscreatecongetseuserbynamecontext_newcontext_range_setlibcrypto.so.10inflateEnddeflatedeflateInit_inflatedeflateEndinflateInit_EVP_PKEY_freeBN_newEVP_sha384SSLeayEVP_MD_sizeHMAC_CTX_initEVP_get_digestbynameEVP_CIPHER_CTX_ctrlEVP_ripemd160BN_bn2decBN_bn2binMD5_FinalBIO_ctrlBN_is_bit_setECDSA_SIG_freeEVP_aes_256_cbcEC_POINT_get_affine_coordinates_GFpEC_GROUP_get_orderEC_POINT_cmpRSA_generate_key_exRSA_signHMAC_CTX_cleanupDSA_newEVP_CIPHER_CTX_key_lengthBN_hex2bnDH_newRAND_seedOPENSSL_configEVP_des_cbcBN_CTX_newEVP_CIPHER_CTX_set_key_lengthEC_POINT_clear_freeBN_CTX_freeEVP_des_ede3_cbcRAND_statusEVP_CipherEC_GROUP_set_asn1_flagRAND_bytesEVP_DigestFinalAES_encryptOBJ_nid2snBN_mask_bitsEVP_CipherInitEVP_aes_256_gcmPEM_read_bio_PrivateKeyEC_POINT_is_at_infinityHMAC_FinalRSA_blinding_onRSA_public_decryptEVP_CIPHER_CTX_set_app_dataOPENSSL_add_all_algorithms_noconfEC_POINT_oct2pointEC_POINT_point2octECDH_compute_keyBN_cmpBN_set_wordBN_value_oneEVP_PKEY_get1_DSAEVP_enc_nullEC_GROUP_freeBIO_freeRSA_freeEVP_aes_192_cbcENGINE_register_all_completeRAND_load_fileEC_GROUP_get_degreeEC_KEY_new_by_curve_nameRSA_newEVP_PKEY_get1_EC_KEYEVP_aes_256_ctrEVP_rc4BN_dec2bnERR_error_stringEVP_sha256EVP_CIPHER_CTX_iv_lengthERR_get_errorDH_freeRSA_sizeEVP_sha1EVP_aes_128_cbcEC_GROUP_method_ofBN_CTX_getBN_bin2bnPEM_write_bio_DSAPrivateKeyENGINE_load_builtin_enginesEVP_DigestUpdateHMAC_UpdateECDSA_do_verifyECDSA_do_signEC_KEY_set_public_keyEC_POINT_mulBN_freeDH_sizeBN_CTX_startFIPS_modeEVP_aes_128_gcmMD5_InitEC_KEY_generate_keyBN_num_bitsEVP_aes_192_ctrEC_KEY_set_asn1_flagAES_set_encrypt_keyBN_copyEC_KEY_get0_public_keyDH_generate_keyEC_POINT_freeEVP_CIPHER_CTX_get_app_dataEVP_DigestInitEVP_bf_cbcBN_clear_freeEVP_PKEY_get1_RSABN_randEVP_CIPHER_CTX_initEC_KEY_set_groupEVP_aes_128_ctrEC_KEY_get0_private_keyBN_divEVP_md5BIO_newECDSA_SIG_newDSA_freeDSA_generate_keyRAND_cleanupEC_GROUP_cmpPEM_write_bio_ECPrivateKeyCRYPTO_freeEC_KEY_get0_groupBIO_s_memEC_POINT_newEVP_cast5_cbcMD5_UpdateEC_KEY_freeRSA_private_decryptBN_set_bitEC_GROUP_new_by_curve_nameDSA_generate_parameters_exEVP_CIPHER_CTX_cleanupRSA_public_encryptBN_subEC_METHOD_get_field_typeEC_GROUP_get_curve_nameBIO_new_mem_bufHMAC_InitBN_dupEVP_sha512PEM_write_bio_RSAPrivateKeySSLeay_versionlibdl.so.2libldap-2.4.so.2liblber-2.4.so.2libutil.so.1logwtmplogoutopenptyloginlibz.so.1libnsl.so.1libcrypt.so.1libresolv.so.2libgssapi_krb5.so.2gss_acquire_credgss_indicate_mechsgss_inquire_cred_by_mechgss_delete_sec_contextgss_import_namegss_test_oid_set_membergss_compare_namegss_release_credgss_display_namegss_display_statusgss_accept_sec_contextgss_add_oid_set_memberGSS_C_NT_HOSTBASED_SERVICEgss_release_namegss_verify_micgss_krb5_copy_ccachegss_release_buffergss_inquire_credGSS_C_NT_USER_NAMEgss_export_namegss_init_sec_contextgss_create_empty_oid_setgss_release_oid_setgss_get_miclibkrb5.so.3krb5_free_error_messagekrb5_unparse_namekrb5_cc_get_principalkrb5_aname_to_localnamekrb5_get_profilekrb5_cc_get_namekrb5_get_error_messagekrb5_get_init_creds_passwordkrb5_parse_namekrb5_free_unparsed_namekrb5_cc_initializekrb5_kuserokkrb5_cc_resolveprofile_get_stringkrb5_cc_get_typekrb5_init_contextkrb5_cc_destroykrb5_verify_init_credskrb5_cc_store_credkrb5_free_contextkrb5_free_principalkrb5_cc_closekrb5_sname_to_principallibk5crypto.so.3libcom_err.so.2libgcc_s.so.1__aeabi_unwind_cpp_pr0__aeabi_unwind_cpp_pr1libc.so.6setuidchrootsocketfflush__rawmemchrfchmod__printf_chkexeclexecvgai_strerrorstrncmpstrrchrpipe__strdupperror__prognameconnectftruncate64getpwuidmmap64__fdelt_chkclosedirinitgroupsinet_ntoananosleepgetgrgid__read_chkinet_ntopstrncpyforksigprocmaskfutimes__stack_chk_faildaemonunlinkputcharlistenselectmkdirreallocabortstdinstrtoll_exitsocketpairstrpbrkpopengetpidkillstrspnstrftimerewindstrtokendpwentstrtolisattyfeofsymlinkcfsetispeedfgetcexeclpfgetsgetpwnamcallocstrlensigemptysetopenloggetaddrinfomemsetdirnamecfgetospeedstrstrtcsendbreakrmdir__errno_locationtcsetattrbindchdirreadmemcmpgetnameinfo__syslog_chkendgrentgetsockoptsetgroupsttynamedup2unsetenv__fxstat64shutdownpoll__fprintf_chksigaddsetctimegetgrnamfchownstdoutfputcfputssetresgidmemcpyfclose__memmove_chk__vsnprintf_chkstrtoulsetsockoptmallockillpgumaskstrcasecmpraisesetegidgetpeernamegetgid__lxstat64opendirgetspnam__xstat64__ctype_b_locgetenvsscanfsetresuidstderrioctlalarmsetrlimit64munmapgethostbyname__snprintf_chkseteuidgetgroupsreadvgetuidreadlinkfscanfexecvegetegidgetpgidindexstrncasecmpsendmsg__realpath_chkfilenopclosegethostnamefstatvfs64usleepgetcwdfwritegettimeofdayrenamesigactiongeteuid__memcpy_chkclock_gettimewaitpidvhanguplocaltimelseek64strchrgetsockname__poll_chkfdopenreaddir64accepttcgetattr__ctype_toupper_loc__ctype_tolower_loc__cxa_finalizefreeaddrinfo__vasprintf_chksetsidfcntlcfsetospeedcfgetispeedinnetgrgetprotobynamememmovefopen64getgrouplistsetgidstrcmprecvmsg__asprintf_chk__libc_start_maindirfdcloselogsnprintfsysconfprogram_invocation_short_name__environ__cxa_atexitld-linux-armhf.so.3__stack_chk_guard__data_start_edata__bss_start__bss_start____bss_end____end____libc_csu_init__libc_csu_finiGCC_3.5GLIBC_2.4krb5_3_MITLIBPAM_1.0GLIBC_2.16GLIBC_2.15GLIBC_2.8GLIBC_2.17gssapi_krb5_2_MITOPENSSL_1.0.1OPENSSL_1.0.1_EC           U&y   ii   ii # ii   )0  `/h9`ii  ii $  4 l!+j 3 t l" " " " " " " " " " " " #  # # # $# ,# 0# 4# 8# <# @# D# H# L# P# T# X# \# `# d# h# l# p# t# x# |# # # # # # # # # # # # $ $ $ ($ 4$ @$ L$ X$ d$ p$ |$ $ $ $ $ $ $ $ $ $ $ %  % % $% 0% <% H% T% `% l% x% % % % % % % % % % % % & &  & ,& 8& D& P& \& h& t& & & & & & & & & & & & ' ' ' (' 4' @' L' X' d' p' |' ' ' ' ' ' ' ' ' ' ' (  ( ( 0( 8( @( H( X( `( h( x( ( ( ( ( ( ( ( ( ( ( ( ( ( ) ) ) $) ,) 8) @) H) P) X) `) h) p) x) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) * * * *  * (* 8* @* H* P* X* `* h* p* x* * * * * * * * * * * * * * * * * + + +  + + $+ (+ 8+ <+ L+ P+ `+ d+ t+ x+ + + + + + + + + + + + + , , , , <, D, L, T, \, d, l, t, |, , , , , , , , , , , , , , , , -  - - - -  - $- ,- 0- 4- <- @- D- L- P- T- h- - - - - - - . @. d. . . . . /  > > > > > > > > > > > > > > > > > > > > > > > > > > > ? ?  ? ? ? ? ?  ? ,? 0? 4? 8? @? D? H? L? P? T? X? \? `? d? h? l? t? x? |? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ @ @  @ $@ (@ ,@ 0@ 4@ 8@ <@ @@ D@ H@ L@ P@ T@ X@ h@ p@ t@ x@ |@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ A A A (A 4A @A LA XA dA pA A A A A A A A A A A  B B $B 0B t3 >p4 >4 >3 3 4 x> > -> H> `> > ? (?  \8 ?`8 @d8 Ah8 Bl8 Cp8 Dt8 Fx8 G|8 I8 J8 K8 L8 M8 N8 O8 P8 R8 S8 T8 U8 V8 W8 X8 Y8 Z8 [8 \8 ]8 ^8 _8 a8 b8 c8 d8 f8 g8 h8 i8 j8 k8 l9 m9 n9 o 9 p9 q9 r9 s9 t 9 u$9 v(9 w,9 x09 y49 z89 {<9 |@9 }D9 ~H9 L9 P9 T9 X9 \9 `9 d9 h9 l9 p9 t9 x9 |9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : : :  : : : : :  : $: (: ,: 0: 4: 8: <: @: D: H: L: P: T: X: \: `: d: h: l: p: t: x: |: : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : ; ; ;  ; ; ; ; ;  ; $; (; ,; 0; 4; 8; <; @; D; H; L;  P;  T;  X;  \; `; d; h; l; p; t; x; |; ; ; ; ; ; ; ; ; ; ;  ; !; "; #; $; %; &; '; ); *; +; ,; -; .; /; 0; 1; 2; 3; 4; 5; 6; 7< 9< :< ; < << =< >< ?< @ < A$< B(< C,< D0< E4< F8< G<< H@< ID< JH< KL< LP< MT< NX< O\< P`< Qd< Rh< Sl< Up< Vt< Wx< X|< Y< Z< [< \< ]< ^< _< `< a< b< d< e< f< g< h< i< j< k< l< m< n< o< p< q< r< s< t< u< v< w< x< y< z= {= |= } = ~= = = =  = $= (= ,= 0= 4= 8= <= @= D= H= L= P= T= X= \= `= d= h= l= p= t= x= |= = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = > > >  > > > > >  > $> (> ,> 0> 4> 8> <> @> D> H> L> P> T> X> \> `> d> h> l> p> t> @-v-ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ p@-M@M0@0 00"0R4 `a+_P@y[P+[0[0RA7 4[PjHؿ0O-M?M菟/0<0 ` @80 <0)@0D0e),凕?0(0ڕtPQP8 T/P? 0@,@;8?T0(PpO;YP ^P0ϞP$P cpพ'봾n Ο ` Ο $. #pL 4@AP,*('&%$#"! xr/^ W  :'ysnYd=0:pT= 0 D=0 R4 |,=0,R  0j( 01)0 0,<0$ {< 0< v< 08 4 p|< 00 kH<,0[1pdH< 0$]8< 0$XA 0 0@P J > 0<0A; 0 <; 0|,7;0 Ru\ 0*_0  1S= D  00 [:0:: 0  +  ?(P :0^_p,  T=# ?: 04 8S88* 0'01 :0=_$p( 8 < ) : 0 <@P))9 0 0 90|,R |,ի) 80S ) ) < R )  R R /R X SGW \G(9(0 ɟ |x,q 0r S0| hi`P h 8`0< Q   k,0P <0Sdڌh`8080S$ `h8080SX8Th0P(` 42(10S 0hq`%00Sk @D A0 4P0cS d. p,, SXSn`HUVH>0S40S >00SQ d~2ܮp `(`\IO=0S0S D0Su ?0d<Sf 0/ 0 0 C0 ,0SH;00S< $  < <6 :R0p0 p P J @D 0R W  stJ@KnR0S  P0: ,00 P0 "S$RWc 4`4 g= I<@P 0<0 80Ph J\I @T <0 @ 0D0Dp1 x8p sH@0@ G8ȟ(0 x,| 0! 8 0 RP< 0X<0@0D0p@ T8 0<0 @ 0D02T\PLJD0P5Ec0  0 t,)h R PPDW@w@P8g8p,` / 70 0! 0!!@, T6Ɵ0 , 0 yKl ![K<0pAhVhP Q@P L& 0H# 0 L KnE_ >P$PPR "~L{ 0S0TuLr{pm8l0iP 50ETMZWKH GI A L 9 L | 1 l$0( 2 L@ 8  (40p<$ D@xp0q Q0@  B(HK(0@ |3`rMpM`v [1&4U0 0TPSP& 30 R"  2 00 T 0 .T00SxxTX@  $`PX P 2"0  9! 6 nk렻$HXD,X ء4 ,dT@h_xTl_XܓȞLlTؓ T̒L@$TPHXX$|@lЙHL((pD Г|`L00B1 S 00 0X tdp  00 c  0 @K 0 0" 0Z  --($0 -00L`(P0 0 R/,x< <   `@-R$00 0S3/,(T@-@@0< 00` C1?0  R2/Ԕ̔L @- D0 0R4 0S (i0 0 |L{<4@-,0 0R  0S 3/@4q@0@0< - 0 M 0R Ѝ-먅0ē0 0G- MX0U0ڜ0 `@0p 0S @T  \ V0SQ0 0RЍQ T08<0< 0- M0   0R Ѝx0<0< 0- M0   0R Ѝ,000 G- M(`0R0$ڤp@㠐Pᜀp 00S 8P@S8P00S 00S 0RЍ0H00 A- M0 S  l`-\` R Xp@p0p p0@S 0RЍj0 0̐0 @-0x` Mp@`hP P0PER0@L0S (0P0  ЍC<0Pd0d 0p@-M@00H 0D  0`P_ `0RЍp#뤁0`0` 0p@-M@00P`E00 0`  0RЍp(000 @- 0M 0R0 t000S PUp@T 0관0@\y|0| 0@- M`00BpP  P 0S 0 p0R Ѝ000 0@- P M 0R0! 00$, 0P 0x0t@0@$k4`o  τ 0R Ѝ0@艄0}l0x|x<tXxhPA- AM`(@,P P 0 00S0 (6P( 0R#ЍfP  0YPhhB\+P @@5/00/p~0ԆXwhvȋ PP gP} I0@St@/p i,0D\0L0D0P0`3 0 .x300S 0ST T 0RЍ\00\0\S0, $0JpiL\`$$$|4dgn,P @]4܁, n i ``0,;1` 0 /D!1L0DPH| x, 0F100S $u|$$nuTTA5@.ᗁ0@x  k.00 P[C8w04o \@<0l4L|ԁ (|mtXm(Ll,lXl4Ly(k,j$LhPwh@hhXP1P!O-0HAM @0P 0 K2PT,P, 8S1p@`p`052 =,  R[  m8@S0QP 2P 0 Pp X6 0RЍl0 h0Pd 0- M0  H  (P 8    0R Ѝk0،ph0Pd 0- M0  H  (P 8   0R Ѝ{k0X@-PAM1@0` 0 0&P!00,00p'pW10  0 P@@ P 0RЍ00 00ppW"0 0 OP@&00`00P 0\00`00P 0똋tj0dd1!0@-0A M0P@$ 0R01(0$0PJ tPH10 RI 0S%,100SA |@p@3100S "00(0S 0S 000S |P 0Qڔ0 P "P 0@X D0HM@000S@h0vpTv, v\pc_xcoO-BM,Mß *$00 00\?p@ 8P 0p 0: S l  -\:\/0RBݍ,ЍH$PP o oO# 3(p@ 0, 004 Pz B-( 0 S S* G0 S S S#S S  P J΍>0LCJ.0A 0( PDE + 匉 4-SN +SJ΍L4  (-R; +R. B(S0 R. @SD  [ P 6P0@S- $.P0Si -c4-0-~ V,-u(A L4 0$ KPb  0 A P 0 :PQ f0xDww xwwLvO-IMࣟ MßP  @ (p崳ଃ `D[I 0 R PE0S (0P c `0P P2`T<S* @0S$  S! B@,$0RIލ ЍE` PH P 80DŸ 0 $Ÿ   @0SE  SB   ,Y  0   PT<S4<S $,YdE  00P  0  ,QE 0,80 0u,z n,s@@ X b,gb0Muu8uttutsu0` L P/D$40 p.p0 `Lp `@ 3[` 0RЍ{ `@ "`{|P]P a0PsP F0a`laa404 0- M0   0R ЍtD0 1 0!C- PM@T  p`0-(0@0 Q  0RЍp-ll p`0(0xL0 X y0D0R8^p^0 0O-M@ P``p0 (0JR0`P N00Q A[  0RЍ0 (0p,Y ` 0P 0NB08]PH0H0D - 0 M 0R Ѝ3A0@P  0@-0PM@ Q)nPp )nLPpX0 pPL 0pEΌ 0RЍlA0O0 C-MP@)~PL0 `R@d00Q AQ  0R ЍLY `0@0Nx2x"0O-$M @  P񏐅DRnA@?>=<tIq" QX ŸA@q pP`0 (0qR0 v0S C   ( @0\0Yp000 ^$dP& 0R0 +$ЍOUP0 M@ 0 X 8 0R $Ѝ8@ 0R 0 D+@\ 0 0R 88$ЍO.?0 N8ZtYXXY00 A- @M`080upKZP0 PpPP 0 00g 0RЍ@=0(X1O-`x0MPD@0<0)D10QDPP /8pN80 P_ (00``A,p  $`0 Ew@P] 0g`9PU< 0RЍ0]SS aS 8u"PP<0'WHW Q9 1Q010Q7 tM Q 0SH10Q, 8  Q 0S 10q(  Q 0Q00000000000~00{00x00u00r00o00l{ 0 0f*0(J4HdH HHGGpG,G G,GFGGF1GFFFFFxFF 0Q 0@- M P   P  @P R\  PH Ѝ0@T 0R Ѝ0  (%0Ep@E0O-`Q0M@0 0 B☐P㔰p pT 0 0T R P0U 0RЍ ,%0 DD0P0A-M p`P00$ 00 0P R  |xPE@V @ T 0R ЍAq  L$08ClhTpCC-TM,pP쀟@P0 t 0`3  $(L 0)P   0S0L00P TЍT(@@[8 qkP#02BB0G-`0M\@ 0 0004s04T0S {A pP0  0@S 0R Ѝ 0R  0 AЍG~+<"0|1xh%0O-M @m-0}] 0(!00( 4$<(<,<0<4<8<<<@,<0<s00<4<s04<8<s08<<<s0<<@<s0@<D<s0D<H<s 0H<L<s0L<P<S T 0S; |W0S 4PH 0S PC 0%0S P SRP 0 DP Pm` 4PH 0S 5p 0s4PH 0S 0(  pn`4PH 0S ySJ nS0oSP 0  Y4PPH{ 0Sx [SP H6Pe I6PHP^ 5 P}n `n`3mn ` 4AnS at4PHV 0SS QH QD P r= 0S 0s 1m1l4`nn `n`n`2m `2m?4HTp |<s| knyn` O藟n` Qn`h1m `e1m`4PH 0S  O0SE A1m`Qn`N3m`K3m `HDH0  vH0S/ 3PH)3Hpi x<sx 䖟n VnDPUw 0S0S $q@T|3PH 0S~ aS0 0nS0ySZ0S x 3PH 0S UPY^PPx P,1 r3PpH 0S =DP (X0S 00磎&n`n`nn `n`Sg  0S b0S_ pW0 0-}pq5T3PPHK-l`,tH0  H0Sw A3PHq;3PH 0S 0Se <Sb5P YS `Q0S 0S 0SPpH00>01 3PH30SH3 LQ0S/,D@(0h0S H10S0@/S  P @H1D@Tm 0I0S \Q0S@P  z@P f2HV9p 2PH M9pk 0S\` 2PH 0S (P l<SH@l -l `2PHR 0SO 0S 0SX000-l`[n`X8偎SaAn`<  0Sc 4S0S_2PH 0S P002P001Sʘ  p07l8? BA4A@@?P0BpA6(8|@6hH,4=$;(0:< 7 p7 ,**@)$D.h***X(p+-(*P&#0' )0'h%t(p< ('"d"@!!!h4"\'"'&0X !  !$%$$ %@D%D%h`H$ 1l(`n `n`1PH 0S 0S DQ0SP4m1l<`<S?0a<  O3m`n `1PHU 0SR 0S 8Q0S2m`2m`-l`-l`-l`nr1PH 0S )Pt p<Sp c1PH 0S I-Pn h<SH h Q1PHt 0Sq P d<SyH d un`;1PHl 0Si p$W0S 00 S~ pq#1PHT 0SQ p Wl0S 00 C~ p 1PH= 0S: p(W0S 00 c~ p 0Sd0PHY 0SV 0S Y sP0P P Us  0PH 0S <lPp  > 01Hi ZP0S T0P *   p Hp0PH,> 01nn4n` M-l`n0PHB 0S? -=8 <0P P,-<  @p&60`KH0  0eS0sS0S   R $|PW `V 0P "<P ; P 0;[PW P P 40pEP5W P  P_ }| 00U\_h  /- 0  0PzS x01  & PNWL PI  P#A@,-< 0R<00CcSL   r:rP :mP  PpgpR %RIR00S   JD  0<P 0p  W 0S P( 0%l  8S x H0i/PH 0S 0PY 1pHPO PL0S x 80:$;0r,+ k4  z <T\ hda t     H0   0            0  , 0DH0S@<0D   H0S\<0`   H0Sx<0|         }   x   s   n   i   d V    ZH0S4=08   QH   LX   Gh   Bx   =   8H0S=0   /  u pH0S 0S       $  zH@0  T\  l  |  H0          H0S>0    H0  (  8  H  X1 0O-M M`hd0ʍ? D (pP> 0P @ PpP6 #P000 R  R ^  T #P@ @(Hs኱ lp/0RڍЍ bJ,  JH0%@x$`$!1O- $M@Q` 0000C qЁБp̡1 0 0! P:   P8   P6   P4 -p: U @,PPP000S  PU  0R'$Ѝ 0xt  c 0DD  @V0$$$$$$($,$ #"00- M0 R  R 0Q  ЍQ Pp0050ş0O- MHA0q0<s<<s<<s<<s<<s<<s<<s<<s<0S 00LA0S 000<`ps0<<s<<s<<s<,1 r t<st<H<sH<D<sD<L<sL<= r = r \<s\<`<s`<41 r P1@UT@X1 Mr 0S 00M0S 00 0Q0P000 RX0S @@0S cN @@@@0SX0S @@0S N@p@@@0S`A0S 00 R >0Q0PY000 R[$A0S 008A0S 00 0R Ѝ?0(O-@ ! pM 0 `0 0Z ,0=0w030P P@ P0 p @PPZU  0RЍ  0 A-MxP0Mt0)Pp `0:P 0L   E9*0Rݍ0ЍL0,O-M∶ M&@ 0 S0 D4 `v`Pp P0S,p,) Z, Ɵ@`  P @ @ p  se 2 >@T 4 p0P0 S0 @T@(1$(,H=3=4=:=;04)8 89 /  =>@?A<@DLTX !#.t~=6z=7v"sP3H0n41j- 0P*d+h =5$1F~81Gz=Mv<1LrD1Nn\1QjH1RfL1SbU_| F Zx U =-,$ <A. |. w % r0C-( &l4S-, 'f8c-0 (`8-8 BZ`1-$ T0S dqs]0P`p `80S-,< 0 },1Q/ 0R* 0Y.!rC\ n0 c` g0X1P1 WD$0R ݍ ЍF@00  0$$L8\@0@0< - 0 M 0R Ѝ00 0A-M@pl`0`0i\pP_ P8  0RЍ0$ 1 !00@- MP@0@0P- p  p3@@d  x0P0  Ѝ0( 0R  Ѝ0@($D0<40@- M@0@P00~J| x0t0pt0lh0h\0d 0R@0 Ѝ0@ZS0 dx$p@-MA!@1P  00S100S/|13 0RR`1Ѝp@) 0RHЍp@00a(1` 1a 1^0`0_ Z0[0\b0]PcdQR 0R\0Ѝp@0L\dXxP P0 L0D@-M @00 0RЍ@0G-M0R0,"Pp000G@` P1100(Zk 0Sh /p {10, ! R. PV UR  0RDЍ,P$ P01V 0 QPYV I#qQ R t< P/ pPt0%PV@@0@dT\,X|0 0@-M@00P  L0P0 Ѝ0 03 00,P1P!0A-Mp00`~@ 0EPP- P RRP X d+pV 0RЍA8;P)+X PcH4 44 W$,0:|8lO-4MT(4Pp 0,0@s`qo 0Pe P$ 0 0P\ P O\  300 , 0R4Ѝ8Pʘ30[0 ɠ 0  ŸP30#P43 Z 0` Sㄐ刀 [00p$ P$| 0  d20<( P200S# 0$  a _0@ST!,1 0J 100Sp P f_$0  0 0v0 ) P| 06[x(0$! 0o  )1%!o 4 2jg ? %]09l$($TP (<DTP p0 0A-M@0 0,p*`(P& Pp P 0 0R Ѝ0 0? 0h$X\0\0X - M R8 0 0P Ѝ0LO-xxT PPP TL#, ᩥU M|0@|@ ԤP P ͤ@*PT@@PWPP0 0ᷤPd00ᱤPP Qt3 00\_  U B $ 古P  S@ 冤F 値| |RPd@xP <`o/ix0xpBkl@xt` |0,0⚣P☣d▣$P$2 0,$P 2 0,P( 1 0@0 峻;V|P# 㹽P P 00)  R"\PA@VVVsA@P0D0rQ:1eU!P4 0R<Ѝ谽0$`DD@(,LxO-*$ `ꖺ0S P_ S0\SZ 0!SWP 9~P00 `ᚹt `\ *D $0<H(H-0 0p@- MP@`800j  8 0卽P 80S  0R Ѝp@ Ѝ/D0)O-@R`pPDMh0$<000SV  Yz20(0Xb Zh Y,h x" 0 =`200S 8LŸ^ 4 <Ÿ 04,0     ( 0S+0P2 (10S.  0S* QP% 1  0R $ 0RL,ЍrLV :˶PpsD6(0 S U S@D PT c:㥶P` p1  Z 녴h0$̡d @<̮$ ؔpГ\4@Hlx10p@-M`P 00-@P(U# ॵP0S PP=A2> =f 0RЍp)@+4 40 $!$0$dD0A-p0M@`00P бP 0@:S S,S 0RЍX @ִP ᳱP0޳0l0l 00@- M@P500I@q 0R$$ Ѝ0@꿳0$h00C- M pD`0V0 @P@PE@T  P  0R Ѝꖳ딗0G-pM = l  p*  Ap C/ @0`TpWV`0Px pbT00 l 0R pЍUQ0\0\ 0X- M 000 Q ЍQ ЍX40d0d0` 0@- M@P @'  0R Ѝ0@2 p0\ l0l0p@-M `AXP``00S @0T Ѝp@B 0RЍp0T1T!O-0M Q0 0B P6  @p,P``p0S PH:ٴPp%P 0S@o M 0RЍY 0S 0S V@@< @R$N꛲p0|D1D!0@O-M `` p0S 0R;ЍPDP@0S% M0$@ 00P,0SiP D PSD@DI 0SD0S,B0@10O-` pM0 4 0YD[L X100 0  Z/@P  A @R0PsY0P  ,R ᆯ@  Q D Z0S  0R Ѝ@ ,,4б딑0d$O-P d@` ,MQ0$0qTp@0 0S]#(10SoT 0S0S}000- RXC@Y$ Q  P⹖Ǘp000TL 뼏0ؗԎ $48p\,O-$Mxt@Rt4p0000 |`yv 0P,$ /ᗲ:P00ᏲP000S00f30S(j(0S  ıP t,(`#(1 0 S 0S L 00S0$#S # AR>0S$ 8[, 300S  =P ਭP 20 0S GZ 0} ᪭P T  k$Ps ePn=?U000^ 豟 Z !`1 p 0S 0S  B PW $PZh 0_] 0R6$ЍOT$FN = 0R03/m[oPG Gr0 0@ | ~|t  0됯X\0 $PhdlxԍO-lM40ğ@0, Tp  $0DP0` 00d00( ܓ000 г0 00委ᥔ 430030030 030 0 ᙰPV0dPÔῬZP 8@P <d`P <  < K nP9 hPA Z0S 0P 00T ᅬVr @〬\Zd 0R~lЍ =P0  6P*$0@jPQ 0SR0@]PV 0S00Jh 46P P, pyP` ><P(0k P00b`H, 4 [4e @ K1{@*t% pp g\bft00t@8$dh` 0p@- PM`P@ T000 000 00ʫȫ@Tt@@P 00X@@ P 0 0 00P0 Ѝp@a0X(O-,MP 0 0$0U 0 S iy崉`ఙpହ9 00)@  R/ R Rs ,R Pm Rk  6P  0PD  *PG   $PJ   PV  P  PR( @ P ;ᖮ$||ȟ t 0@P PUm "U \U0"S@0@`( @W' @N'  $ 0R,Ѝ@<' s ෭PMp' @ P <HHǟ @   0@P PU "U \U0"S @0 @& =fv`p  嫪PV0P 0 \600<SKH \P~ 0 UP  NP@@׭e R0 "R  P@"R  @ PRUP 0  Wd5 0 TP@4 P @᛭)P@ 00S "S \S "R@ dt`p  e  Pn@  W(0-@g` P@00S! "S, \S "R@ H @P@00S@ "SD \S "R@ |c` = ɩ   qP Pl pC@ ! 嫩 0 20 `(  @P  P d  Pa PQ PK0,3},b`$2  00@0W! P  0QP0W q @@LFp봫da`  00 0S(10$ [ 0 R0xXH$XPLČ$l D(pTD<T4(؀|(|(Ÿ0$" C-DMp@` @ $@(@,@< 0@4080PP@A 1@@c 080 $00(00,0 00004000pV h1 `04 $PR`( P,0@`  P 4 00 <0Q2DЍ@!4P0 8PP PP np Pؑ@P 000P$0 0P(00,0 00TpǪu040 A-0`M` 0R0tp@Pp0P@0 0S 0RЍ蚪s0Dx00 0@- M@PP <00PU zx(ɪ 0R Ѝ0@Alos0D0 0p@-M@P00崞`P Zᇪ0 S0 RЍp@(R Ѝp 0R Ѝp@?@\r01!0C-`p Mx00aZ`10QG@ \> 0S; 0s70s4 V  P0 rP0 P 0 rP㇧|P儧|P偧P~P{ 0PR Ѝ @R8(ܿ֩q0 0,00 0@- P M0^0 @\ \ @QL 0R Ѝ0 ꢩo0x(@2@"0A-M`0B0@0# PHPp  0  㑩PP2pn 6 l ⼁Kn #P? QPCx 0Ƞ P Mp 0R?Ѝd@00 ͦT yǦu . 0 00ꢪF@ꘪ<l@ꏪ3L埦 坦 o0~drT}}x`00 0@- MP@ P 0R Ѝ0X ͎ۏ@  0R Ѝ0@g֨l04İ\2\0O-AM xPJ 圣PJTS418PpW $P d81P ݢPNJ 0 000 pNz ڢآ֢꺦^pd=7T9LF<AT_0 _d^8^lxlpPDO-@MM M>(004`00Ss-`,R (\< (10S J(P (10S <S 0$SP͟ $ d0408P x4p080SМY̐H0S 0!00Y: ,0 ,0 ,0 00S l<0h,̐ P L< 000 卥$, 0 , $0 gP c 0<S+[  0=SS 0S=S=S 00 [ᴎ֎4+0   B + 0 qx뇍囎὎ ʟ0   ( ὡ* 0 U 0s *80 L0S d* D|0S H* <8:00S (* 2 0P (0X0S ) (10S90 0S ) <S <S 90 00Se8pЬZ};d90pPR;<S ;0S_ S J<S4$/h( P$R M>$( # Cv$㵡003.\8\$ P0O 0s) 803 ,HEˣ@ ȡ7 0,0018p0S ̷,p 8 0Sp~7-0"yd h dd a dP|[ [ 0S$10S( Ɵ   P 0SBPPF [ &0 娡tG0S xV8 Pὠp  TſH@P̐  ᪣PC 5 0ɤ60< 0 /R R50ş0 0 ̣ x81P BP4%0 05٠`%0 M 0@@% D(\( e`P PUM1P,PM1$,0`0P 00h뚠 0$D @x  d$  だucPz@cx`k$੠0/ [ P<S RP̖#0    8 bPPp #0 ̠0#0 0   -00DP00$r1 # 3 0娠b( $⤐a200SŸ  ᳟P$"0    0SFl PP6 [ H"0 mP:l$"$2 0aD" 0 X ! P N 0 ! Pꗠ;ʻꏠ3»ꇠ+ົ#0 ௻t|0 pऻ DdG0VLdȣx8(tHD1!0p@-@PPM004 0s 8` »PSP $p P0 0 0R"Ѝp$p 0 8P$`廜 <I 0R Ѝp@?ꎞD0TСd`0` 0\- M 00S0Q ЍQ Ѝ:oB0$d0d 00@- MP@0Q0 ο 0 0 0R Ѝ0Q\B0D0D 00@- M@P00m 0R Ѝ0@ UI UJ UN UO UP UQ UR UA UQ UR US  U$ ]Wupɺd ϝ0S  0s 2 0R3Ѝ QPRN끝x 偳A0Q\X44L$l 0`}D10O-M 0R0W @ 0 S@Flph1Pd00  0 +?p,1P@00U00S 0s 8`  P=` /ўP`W + d?W  0R   ЍO>l+h? 0R@ЍO袹,>0MlMhM(M@GLpXLx|A-MR@"P2`  00Sb 0sl {10S<(,004pWG ູ1 p8P 0S@0( 8p3P(` হ0S6 ]0S3 (-P34 0R(Ѝ,(p3P P0P0 0)pn fPhD Df8 &4^0<0|P$<`Ě8tEEA-`PdC(M`3@p0$0 ^PZPVP;pPO P/"2 0|0x,GPg ㌛Ph  ホPc zPJ @2|0\`,$2灁  20@T# 0UU<  Κ̚ʚȚƚ Ě$ 0RP(ЍP 0P@ )͙$\ 彙< I 屙< = 冚儚塙< - vtrprTt90HL4̊00܉P4l C-@b M"$1`p  PUY 2 0P1 0S00`60S0sU. (P 0 200S!B 0s* j@!1 祀 0Rg Ѝ 0 S0S000; 0s 00Sh@D10PU 410 0岘P  00S000 S 0S00̷00PU Q PE P Q භt P௷wPu 0L୰맚60lEhL$D4shCȕ ԕ|t@-P0A M,1@ p00具 0s Q 000S0 0 0|P 0S @a0@`0S 0R Ѝ@ ;E204$<1$ 0n `1a`ᮙP?00HP$` ҕ`V#5P\m`P廕幕000L`< `(.`㣕 塕 ƕP00^`p !8 ഴt!t)8 ઴d\8X! ࡴLD8@! 4,t8(! 8!  8 | > rp.0x|tԑđbP:4HԎ`̎p33H33d3 3@3p33؈L32(323h22@-``A M\1@XP00dD10 R>$R;V $7 !(1p0S70S. <S H0S =000S <S'p(p 0S 偖v0 0000S 0Rh Ѝ@9+P 0R ЍTTDh&0̌5P5$`O-`D$M$@(0p00840S40<#400SPP x$x p$ l d$ `(0  P$ 0  o 0@S񏐎pwv~}|Sz?xwvtsVPToBP0IS~h30<S G ᆽEBh8 ੳ$P00f PP'눐匐<20<S 200S200S] k*0S;h2<'`zP ӽ P5 P^P^ 0RO$Ѝ 8 0tp3pP .꣝8) Y$ "@dPᢓ< 41 0 0S ൲a৲ 1 ಲ [? ਲ I1 $0Di0H<PЇ<@0dt}Ȉh++@|++T++@-$M\A(1X!`@PP   0S9 414q0p0S05 03/P4/ 0    0  4y0S ,y:z<x54000 04P`  y&<<  0$,8L ~~~~~,2O-R$"0 M00n 4pWe 0Sb 0Sb 00 0P`bdPmPCP]0 03/Va @ PГr ទmT i[ [4P+  0R@ P- 0 ЍO  0R@Q XJQ@ST0@lࢨd\떒PD D61 V4,0d-}$}|0}}4h4}H0H 0D@-M 4@ \ Ѝg00 0O-` M R0 0ڐ㌰ VqPJ@@T 0祯P  0RЍ0S/80%%%0 0G-Mpᔠ0 0 0S`tP@ 0ϯp P0@PS 0RЍT0$$0 A-0`Mp` 0R0@PH@w0S 0R ЍAj 0RЍӑ0D$l1l!0O-` MXP R0 001H0@WP 5 A@ KG0 p( pp0S'ڼP`I@P  P0@S 0  \0Q0P Ѝ 4APs0#d#@##""8y\0@- T@MP @ g !㑰 0RЍ0QT0O-`r$M2pP0000@P @ 0R$Ѝ"=!zpz 0l?P0@ .R <SdᔎP! 0  P %P8<S01001 0PP4 U @u@3 0๭00 0P lQPᐭP)`0p ଭV8<S00000 0P  0`Ppo0`0 ``  p0\~P0ଭ0@qꐐ 00xpxP$L$wPw|vTwvvO-200y$00$Pou`"`2 0 :s2s00Sx 00   r  u/s0ސ u+s's s  sss`!  0pH1( 000S 0 (P  0 S v@u 0 ( Pr@u]Y000v@u0  -0Ps rL<_ꊏ 0vvhwuvv("hu$|OsA-M@p0@`00PPʐb00<S@ @ 0RЍN, ,40 I0ts Tp@- @M`@0P0 00ûP&0 <S <S 0 00S0 RЍp@' 0R ЍpRTЍp@8 8?0 ɫ(0$11r4A-M A1@`0 0κp⏻WP uP.000S0Ps@ ᎍ] 0RЍ& Pri @zILPD@|갎, ,A0 sૼh0$qXqO-M*pEP PS ὦT,P  0p ƊQ?W -PI71PP 0$ (0P 000ppChpg0   hP 0)P0` @=0 @RChp0^bb^3]O-DMD`4@ PU0<0E 740 * P$p P $tP Z/ P @@ FPṆ᷆< 0RDЍ,4$ĵpkn$ n kP{n!0Ss (⭵啵P, Pn0l# d3 0 n 2l,0 S ,300Q  lg0 $l0 m  hl $ k 2(@0SQ o!P9 0 (`S9o@ n 0V P@r@ n0T@i b @થd!P[1(00S 8!P/+@H mmo@ n0 !P@q@2.km$ k k k<ů :$7y00[00R9 y0 4| |0 l*0``a`_8_44$^^^,]l\,]]828"0@- M`@P00 R% 0S"0\, \ pW" \B @ P\0\  pW  0  R 0\ T Ѝ @ @ p R pW,  R. @ P\0\  pW  0 pWp) p pWp pW  @ @ ppWpQ  p\    0z0|3|ß0@- M `@P00 R \\ pWq @ 0R 0SJ0SE 0S R P 0S000S0 0 R00 R/ R \x R R 0S 0 R  R 0  Q000 R 0 0 0Rn Ѝ P 0S000S0 0 R0R R   \0\  @S  0 0 0S 0 R   R 0  Q000 R\ \  \0\  @S  0 0nꗆ0X1X!0G-Mp@`0V08 \B0S`PV PU` 0\`` T P0S T00SU 00SY  0RЍ`PV PU` 0S``P =0  0@- M P0 S  @ R 0  bR 0R Ѝ0|  0 00  0l0l 0- M0P0  0P 00cS 0R Ѝ0|0| 0@-M@0P0  0S 00cS 0RЍ DžL0  - M0 S  0 R 0R Ѝ0S R P0Sꞅ0  - M0 S  0 R 0R Ѝ0S  R R0Su0\0\ 0- M0P0 Q0S 0R ЍZx02"0A-Mp`00@@T- `^ P\PU P\ 0VH:% c`P  0PA'  0RDЍ PU 0S 00PU R 0  iP @ 00\pW 0RЍAw@t80,$ ܚք 0QPPLP0 0A-Mp@`0T0fU @P VBU 0RЍ詄00 00@- MP@00 坅p  P0 R  Ѝ0@/R Ѝ0@ꁄP @噂 0 {D0`O81Q4!0A-Mp`00A q<@PPT@Q0U U @P 0R!Ѝ 0 >0 0e0SPP P ề)+(t0XN(N\0\00@- M @P00P  0R Ѝ0   (0MLC-p MP^`0 0 @` P  0RЍ\@܃ 0ڙ0@M0 0@-pP` MP00 @p;p 0 P 0R Ѝ)@ꩃÁ ঙ0L00@- P M@ QPP :Q 0@R  0R Ѝ00끃$ ~ 04LlL4LG-P @p 0MT`00"@0S  40 0 00|@P 0RЍ9t01!0O-` M 0  0W@ P I0@   p p 0 U@@ )p 0RЍ0I8KJl0l 00@- MP\@0@0nlj 00Q 0000 Ѝ0͂T0H0H 0- M0   0R 00 Ѝ!궂0p 1 !0C-M@0 0GdPDd`Ad 0pʟVW#V!!h "PP &f?g l0XA d2O-Mlq`h1p``@0T 00 0R @aPP; 㵽@ b@T0 @0 03/p@}T }eb  m0W0      0R Ѝ40 0 03/pl0X? <1O-$MT@|4Pt0p 000Wa`3b/b+b400SC VC ʜ[` sp, 0S9 30pᷜ WT 3 0` ea\30|a PV  0R$ЍV [Vi VX V6  P200 R 0 R &R W*zpppxt2 p0 ^@X0TŸ 0,0b| | |20焌X0p9" 0 :1!0 WZ 1p0 ,s1 p<S3p1!0 \1<S 됌\1\!X0 , G 0(  ,0pp( P, 0 0 (  0ᬜPp<S ]p~0p0000=4A(=@<@T@th<?? d?>L2@>:>pT<<p0p0l 0@- @P MP R  0R Ѝ01"p3d~0tO-LMP'   D _(@` ``$` R  R (P  T(kpP YY Yb4@$}c  d@&  0`(Q $00 Rf  {a2P`/P0050,0, Q50: , ,  NP ~{ |{_d0  daP}_{ddPww04@$0!c c0F`(Q $00 R  L{=a2P~`/P00x40,0, Q `40,Tර,0 0~0P'{ %{3_1dV`~P {#_!d_d_c~P0~ ~P z_~P zcP by3Y (300S? S8$ 0P= 2@0 nzzz2"0 0S" 20 =b 3_  D 0RuLЍH2@0$ 0P2@0c-c(Q0K $ P13:*c@0.S00z_D~P tze`P~^|c` ,9D  ,((ɒ10 10 00$| $u ⨒|⡒⛒$0L48273l8H<76t6T61t6tddP1d54151T500p@-@PM`0` `哙 0s |8 0~0S TT ~ 0RЍp@A|x0\05 5/40 0p@-P@Mp00]^`P ay 0RЍp|딹03p/L1L!A-0@@ 0MpP Q R5 \2 0\}`P0 ax}a]`{ !000 R 0 R "R *  0RЍ * {  Ñ80x-2O-bM"@`0P A0 00 ՘X"X2 T0<S <,0 0SIp a]20Q]P Ծ %e100 R &Q &\ \(Q (R 0 R 0RCЍ Wzppp R  * O}P.  Y`,0 (嫘p z`F]00?]CW 0S   #P E^  0{@ 4 |0h-0|Ph 001!0G-pM⼡Pa 0` 0",0 0SJ i]cPR 00CSJ@PA R:400P oza;`4[`4_ '000 R 0 R (R * ;x 0RЍzl ࢐` T H < 븴0*T.)h/ h..x.P.-1!0O-`M⼱PA 0N@  0垗,0 0SZ 40SS \pPG  0BS?P6 \0S+ 4wᗽ w0 S  @0@04 y040G_ =\  ) 0 RЍ!z| "p d X L @ 먲0(D,hܺ-,,+,,0@- M@0@000 (1 0Sh0@T{0S 0  yp P w7ꌰ0|&,d0 00@-P@ M|00S[ P  ; 0S ؛ 0R Ѝ0एy뼯0,)%d+808 0- M0   0R Ѝ1y0! @-MP`@p0 vp5  Nxp+  Hxp! 0W 0 00 0R'Ѝx{p"  0xp&  *xp$  0HDzYwp^ d:4yzNwL^ @/8+,'Ȯ0,**#)t#,)) 1 !0@-@PM` 0,R<S/ [ 00 !8$pv^[ + x000 R 0 R ,R * 0RЍx؎ 0(X"0TŸ A- @P@ M0000,R<S~ 4[Ÿ  p0 ! 8(&`6v4^Z [Z -~  vV1x100 R+ ,P -,Q+ Q.P 8.Q6 Q0P $0Q" QRP RR 0 R 0R  Ѝ  R  *   R   R 8x:ܫ0D8&818!0@-@PM$p  0,R<S: Z0 0Z0 0 8`uu]Z 1 &hx000 R 0 R .R *  0RЍwh0ļ$0 0A-@`M  0,R<S( 00,0 pWP (&PPpH]Ytt b / L00@ \ Ѝ(ࠍw0| ,#1 0A- M Pp @   0,R<Se Y R Wa`$0SI x1` 0 8t\pY Z S@ u100 R P Q QTP TR 0 R 0R Ѝ  R  * $ 埴$ (ww44$0L0H!!0 0@-@PM`00}YyYuY %pt}t{ty\X U  0RЍvԤ0d0d 0p@-MP`@00lX륙Y\ w  0RЍpv 00 0O-M`@P0 0NX*Y&Yp"YP|XyX0  ᩙ#t!tt\  yq 0RЍv똣00 0A-MP`@00XMXpJX [ {K  0RЍ[v먢00 0A-MP@p 00X`&X#X s[ }"  0RЍ2v0C-MR@2`Pp00x[[]H\  P0x>\X w PEw[mt00 0R3ЍW? @R3[[\`\ 0EP \U,zWPVX`gP  8[Xsusm ‹x tm⻋d `mⴋ%wsDm 8ઋ\00`,@- M@P0@`p`ro00幒[P 0`@F`YT000 R 0 R R *  0R Ѝ$c]u0p0(!0@-M@00S 00,p3000 R 0 R fR *  0RЍ+u$$w*0XC- M@(1 @P`  0S n3pWx0@[/[  %X g  0R Ѝt  04tO-cM3P` p 0 0cZ@P ز8 @0,( PGV  0RtЍ,0 (ĚV W tpj ,0 (0Ts00gP Ś  rPd=!  P^  0  ጛlsl1`d[Z  WY H p!  p s P  Hs  0$t9t8 4uIr| p*u?rX 40$d84 |0``0 0C-` M⨀@0冏0) tVpPP p zYU  s 0R Ѝs܉̘0,0 0@-@P M0#0aU p=V`t@P 0sP  upP 8:q 0R Ѝ$$#⢉s0d 8 40A-P0M`@W00 4U 0R ЍA$ 0wqs0 p0p 0l - M0 P  0  0 *  R 0R ЍOsX0O-Mu5PpEe0@O`00 0j,0Q  KUz,@ $T / $  pX, 0 0(@V :VQVMVJVGVDV4h%@$V =Q 8V=Q 2V<1Q ,VD1Q &VH1Q  VL1Q V -0S- ` V0`S<Sξ` V<`S 0SC$` U0`S$0SS(` U0`S(0Sc,` U0`S(0S㣽4` U0`S`!0SŽ ` U0`S`2`0SiP L♏  K0SY 200 R P EQC QPP 1PQ/ Q P# R 0 R(10S x100 R 0 R dR *  0R;Ѝ *   R   R 00,jP  o}WU,@j(Tq̕0 |$y`t$ܑp0 0p@-MP`@0@0T,`>T,0`'0T0 ,@0`V?o0` 0RЍpq0<0 0A-MP`@0@0',T,p$ T,0d,X$ ,0崎,@,`V o,` 0RЍsq00 p0l 0h@-M @@ 0<S0Q Ѝ0PЍ@Pq`02O-04M (pP@`0,0  \@0@$brp7 2SA2S `tVPTPp@D E0S- P0S) R  5 3/pmV0!, QP0R*4ЍgrP P o x t߆d `0:0@ <͆p؍0 \ ,` $  p@-MdS@`3PXc0`00oD3 0  300S 20 0Rv R 0Z PX P[20 R 2R0 2R  Rd\200S)0S& R0P 0P 2 0* 0 * 0S R0 R 0 RQP 0 * x10 0S \1R0 0 P P ( 10 0S 12R0 0 2P P 00 0S 0*R0 0 *Q  Q|xt  0l:0pꌋ0(\T|TdXL,̑|O- MDr@"p<2`  P0Si 86B@xxl ً$Q Q0S vP sP T 0S@ZP0S< 0RDЍ00@PD# (Q $ R4PP # ß    ,R " (O(8PO  P S(  "T k `PS( T k0$PHOLPhP"0l t x| @P$@$ lk-xP$@u$ l~kOO@POO 0 ʓxOO@PqOO 0 㷓S zH=)S*mໃ||ⵃ,0h T`LTpH0@HXO-4MU`5@P000,0巊~l |lş0d 0 0,`6l`%`5 \ 0SX H5H0X!R PPW? R  R4P0W? R  R4*P0W? *R  Rt␄dp$4`0P?0 `10PqS% 0S Pc 00(440"R " R? R  RP 0  30,0(00SB (1 RG00(h30,` 0S T3T08nP <P8 ЉP0Skk0, 00Q04Ѝ, {P  2ƱP (1 R 0 0Q f$zR00(\t  2 0,0İ\10,0   ^1 0* X1S.1 0* X1Sx0:0\0:0DP<< I(1$0,0|P10,0q-'!l~0x4\(؆~PXLDXx}xԃxhHPX̂d,Ll0l0h p@-M@\P\`X ` `@( V$0 $(Ѝpklx044 p@-M@ 0@P00^`700<S `0```  0( $ 0 $ ( 0RЍpkw04`P<0< 0- M0   0R Ѝkw0C-pQM1P `r00, @PM |MN^RQ@ URpQ 0 繬PQU P 0RЍ@@HBkl\i$ >v0,xX0X 0T- M 0P P0Q Ѝktu0dO-MA0@`젟p 0 03Q P2N` 0@YP Q 0 PU 0R ЍZlh  <jQlh  ؀t0,C-p$A M 1@Q`P P00 0 @P (l P h ୀ㪂 P /P @P Q0 X  0R Ѝ Djkh s0@\0A-@0pM`p4pP 00喇MpP 0RЍ 0UOjr0D(C-MLQ@H1P`p00OILaEL `AL0 P`P0W0 MP$ "lPP lP )O&O;P p;uO} 0RЍ<<Pi(q0d0O- A$Mq@p`p` @ @H P   O | 2/K L0 l0 ; 0LO 0R$ЍiTp0dXTO-`M3PC@l@00忆NL3 `0iெ0 LP  K0SpKKKKK K h5R@ m0S Km0S KL H  J  J J id0 p0h0 QgH`2L$ 0R,Ѝfd00d\p@- T@M`P @ 00 0RЍpfc0\p@- T@M`P @ 00 ~ 0RЍpfc0Ÿ0A-` MP@p 坃K LL@H LGG HH0S= t0S82tP GGHaLP ݂K 0R"ЍHP  p G $H00 S0 %,*X|LL |f44 |b0L1G-0MQpPC_00 @ TR P`*KI KGG H  ݊ HsP& GGHKXY@ %``L ofL ZdK 0RЍ H$G,0 H$3eh`0x\O-lMT<@4pP000d0J40`0V9tGpGᰌӢᬌ vH  db㼊L ] dHᰊ R YHj⩢`c KHbZ♢`S ;Hbhh>X38 .HH38 )H`'PK&K HK`K H0S ?7 0 G 7 0G @Jd 0RlЍ0`(8GFF F K J  GKJ  GLFhGlaGؙ`nә 0  PF  G @cb  P6  G( $-ca0 0 + rF"F$lF#F 0  `F"uF$ZF#oF\uLLAz;d^0T 4<HDO-pRP,M0$0@0fp`Z 0epH `c c]I0失  M /0 E0P@ qF mFXI  s ta d1  I ka0p. 0p( $ 0R!,ЍMqVbMel 0I0c<<MyHY0d(4 l@-MP@ P 0`s00 pH8F0 00bH$p obP0 0 0R Ѝd$Pa _cV0dp@-M@0@P`PQ_00~| (1 0S PH\0 d00$H 0RЍp$5y/cV0(dDC-MQ1Pap`Uo00K (1 0S, @dH0 f00 gD~Ecx0  H `aHX   0RЍb(xDU0\d4d A-PM0@P`p`Zo00H F0 hP00 i;QDPP H 0R Ѝ4HbT0ldpO-ᐑ$M P A@_O`Hp0L0GH1 j0_00 k D DDC P$0S@ `D`C@ RG 0R$Ѝ4b ( 03xR0\dC-pM1`Pc00GgG DWPE@ @IET0 Pl@Pc_0|*0m {C @HWG 0RЍa4Q0HdTH@-MP@0Pp`p~00~Gl0 nP0T~0 o?#G 0RЍaP0pdp@-M\P@X0P`00F@0 200~G 0RЍpa@O0d@-MP@0pP`00F5Fp0 P0\0 ! CPFF 0RЍ_aN0dO-pl,Mh@`Q` Pm_P`0 T$0x~F$1 0%0 BP-   C00F @  帞崞0h 0@~ $ 0R ,Ѝ84~nF` N0 d(zD@-@PM0pP`r00~T@3FDt0 P00 XnBP9FU 0RЍ`pL0dA-`pM0Pp@w00}E@CDTH0 "00F 0RЍ`K0dA-`,QM(1@P  p00}E2E0 $`0Y0 % B`BP0VX0 BPᏲP ]E 0RЍ<AE`,,DvJ0Ddh$A-@Q M1P`00X},bpP. 00 P" 00 @jE:C]0 &P00 'EnE 0R Ѝ_,u uxI0d A-@Q M0Pp`p00 }00 ҬP& 00 @EB BR]|0 (P00 )>TAPE 0R Ѝ_u@H0Xdp@-pPM0@Pxx`00|DAH0 p00kD 0RЍz_G00d@- PM0pP@`00|DBl0 rP0@0 s@PD 0RЍF_pF0dA-pPM0P@` 00a|D:AhBH0 t00D 0RЍ_E0d@-MP@ 0Pp`  WD &Bd0 *P00 +{@P\D 0RЍ^D0dC-MP@Pp `00)D A0 ,P00 -Mc@ P?A0Y0 X@#D 0RЍ^(D0dA-MP@0Pp`00C A Ad0 0P0v0 1'@PC 0RЍ|^DC0dp@-MP@0P`00C0 .P0O0 /@PCP U H  DD{ 0RЍpJ^B0dn\c4tA-MP@0Pp`00C YA|0 RP00 S? P@00C 0RЍ^A0d@-MP@0`Pp00XCQ# @AQ! ;AQ 6A0T P00 Uq?PRC 0R Ѝ,$]@0dlll@-MP@|0pP`00C?T0 vP00 w:C 0RЍ]?0dO-$MP @P`pHL00B? @W@ @ ?? 0?\0x P0^0y B 0R$Ѝg]4?0kdC-MP@0Pp`00B b? ?v? 0r?T0 zP0+0 {B 0RЍ5](>0dC-MP@0Pp`00xB b@ ?E? 0A?T0 |P00 }yB 0RЍ]d=0dx0O-@ldM RH0L00<\0 R^P y㏏t0S x R 3/P x03/^`P eP7P ]C YP,^,pP  \P 8p[?ZP L ᫩l 0h(,40C40 0 B040C8BL8PD` 40,0  pT $\0S2 TH D0  0X0x!㶂xt+勃|p&ۅpXtXY0 llZἳ\` 0R1ЍH q@xTp3PC凘l [q T 0qpppZ ^0 wppx x|0 whو`ֈ80$hL(ܾ̾X??@LP`??p#0 O-|M@\0`00TLt0\`P dXP[t0SP x R 3/P x03/Pdw:[pP PᬫPYBȁ 0?XXw\P  IZP   8040!Y (W\l [40Ph l0T8 40HAD {@HBAW @vZ5W vY.0 -@-M0@` 0, PZp@ R p t 0 OY@t  P tV rV 0RЍ@ Ѝ/@gV@X,0b2Q"O-0$M 0 0w a庖q䁟 P`ܡpر  @੖%X0PC  @p"  kVP(   eVP"   _VP 4 XVP3}Z@sp V V 0R)$Ѝ}xZ@JY  \p 0S0p   0U0T P0JuHX+0Ĺ ph;hl,Xиn0 00@-M @P  00U P 0QЍ00 <  4   +VPDX)0PTC-Ph,M`A\q`@@# 0$P# X 0 RXp $ 0R5,ЍX`UYp Xv Wp V t V UPt PU0tVW`(0 TO-|M S@3P( `0t0|pP()H\ X P YP .UHPH xF Xp~tHxYd20 Pt 0R<|Ѝ HP 0  WPH 07XP0H  THMU(ݵX HPPT|:tHTPH4WHL!PHWP HLTPLHWLHWT0:STTXX ፔT0  000XW0DS 0IS 0RSXX/XPH (1 0S <X 뉶wT lD'0lt#A-(M@A`<1 @p0$0{00aP8P1 $ 0o=<0  0S00@ P@ 0 S( -@<2T$ 0R (Ѝ @V0 0E0 Us $0$h0.d.O-P4M " 0S$P(P0P,08 0S5 l@P/ 0q0p0 `0$000 0#sT&0S# @DSP 0S R0C\$ 0$(V 5s, 0R84Ѝ#W0S 0@$00S 00S0 S : S00 00`0<}  }묀 S<=0A00U"0$,p@- M$A0 R@P 00001 ``V) ≂00oP)00 @0S N00[S=άAˬS 0R Ѝp0 0L000S<k0 00 rr ઃU` 0$h**@-`RA$M!0@P 0000N `pWF 500PRx10 @ 0S0"pS'8 0 S A| ]}p=pm!0  S 0R1$ЍspSW=T0 ?M|000StCk=| )}PB9< <0 q,-'U0$,8t((@-PRA M1@`000 `0S( P-0 (00S[p@=@AB? 0R| 0 Ѝ@!opL000S@j4 41 q$ڂT0$X6(d''1A-@R!00Mp , e `!X`] e00 S  RX 00Px1$ 0T;:0 S/) Q/ 0 S(/ `9 0S RPR=P别AㅫBカ? 0 ᪢, 0R0Ѝ Qd`-q`0S<^j4 iQT0$P5x4ԩ8;804 0- M0   0R Ѝ9T0A-`MODP\W \ MPO KJ RRR P8h(l HDL 4 A30P04:3P0H l0X0T0DL 0p00 0  (`$\,084L0S ` 0Q  0 ppW MtX$ut0S ott|pkw JJ(40 R hX`K\0 \LLC30<S zd 0RЍzV By00N`P x+1titvt+w| J<|i('{x`yx VkTuxl` P pyPp l0T^Rr^p0lSTp XX^ )sXtX tvyT彾TplXXsz ppch8l( HD,3 _2&30P0X2P0 HX00`0 0 0D \ 巾&b S冉 LTbLbDb<a4a,lT p0aa ! n0 hyaKaaayay0S ?ssivaa0(04$hp؎D$ph@x<10G-M `AP0@ |4CIpP$ 0: S,  S x tEh|$0RPݍ|+  -KP7 0: S pLp{I 0!h|  @ 0  CLL0IOP 0 ]LQP LWIp 0dg,JLJID 08$h$K0tč(PD808 0- M0   0R ЍHK 0P0L 00@-M@P0 0EH  P#3Ѝ0J0D0R #<:0- M 00\ ЍKJX000A-M p@᠀`P00I HP KV * H 0R Ѝ = J0$TC- M`(pPB.@00VIXH P@ W ,GP0L0 V ),  0R ЍuJ s`H0lhC- `MBp@`0 0ه 0P 0RЍNJT0x0x0@- M @`Pp00HL  H P 0R Ѝ,J0Q00@- M P@p`00Hh GP@KP g P@K 0R ЍJP0TQD0D 0- M0Ð T  0XR ЍI0P1-L0@-Pp ` M@P00H( 4S$ S" 3 T13X1}H004S  ,JK,L)FK:.0S3\10 S  0R Ѝ00Wυs \q 3S3S#r`1d1h!h1\!IP000p@-(M@P$0R$0 R`P 2JP  J@8f$ 0R(Ѝp `vpJF,,(fSI0LlԆP@-MMQ@!P4`S0,1pI/GP ),,3B 0P ,!0R$MߍXex I?{IP HJ-GHH X 08eGI00,܃|L0 0p@-MP@0 0I`P5F 3#R4S S 0RЍpLej4SjH0@0 <0- M0$   0R ЍH0@0 <0- M0$   0R ЍHd0@-OM,A (1 @`P041P4!0R;Oߍp I? @ xGT IT t I? @l eI/&G@ P)4,03IuF@@ l 00dLH0phĂ808 0- M0   0R Ѝ3H00B.0p@-M `P@00FLPFP ,} 0PRЍpH  ^l0P0L 0@-BM@M0$4$$0PRBލЍG0C-M,B (2p@`P 0t2HP t"0Rzߍ葟 lGP FP0 Q dF2IE  td)IE\ 0Lrd- bF (I  'I|>?O H D, I_lP = P HE 'dtpm EP .=/?O0Sx0P2 S|0%΍]GL0HL܀\~Ѐ,dP0 L0H@-M @800ud 0RЍ;G0O-M(Q`$1@P0 00 0Ud0DS 0R.ЍGP pF  AQ`G` ,  ,!pWPPDU{DFx0L4O- @`P$Mp 0(0d VL 0DS 0RT$ЍdGP  , 00CS8)0 巻p* 2,0[00 ,)0 堻p ֻp  *P )0L,c``DV D+nF80}$~C-Q M1Pਁ `p P   >DP@GP9 X10@C00<8A?c01@,! 0rEP`@&=! /P%c EPPc  EP 0R ЍC00C`{CPED0PL} L8}|P0 0p@-M@P0P0 0S ` `EPڠ0 0QS SR$R 0R Ѝp P&E sEPE$h`e`T0{\{O-Q@1MP||p` <00b0DS 0RHЍ+FP 1J p p00100 0S 0CS ]F P!FP  p 0W   p0P MDP PPBUB<0  .+  *+AE80 yXz L4O-Q@1MPp` P02Yb0DS"0RTߍ >EP EP 4!J01   0 0  00CS(00 C 0  Z0 C00 EPCP PPfBUbBz0  D0Xwx A-`8Ap41M@,,P `00a 0S S@  0R3Ѝ @ 0V$`)000 R (00S000<S |' ᏹ@t@)'4@ anD0puwxv@- @P0 M@p`ppp00a000S" PU0 000   0R Ѝ00  ,-Z'D00tvlPuO-DMuş`p ,@ $0p0l`hP<05aH500R) r00m6Pj'p`c&D V|40Dh`0Q 0SD`0 D,4  )0@A0 V300 R (00S300<SSPP`3%30.%'+% Pp!xSPl`Wa % [4S0P 1 0 %`c`V 0 p pW %9AP pyD _W$0 00 @< 0R}DЍ0QtD2 0 ]$0@p 0 c0  V`r0``@0` р  l000 0 G @$00 0|@0 0 0 $000 j@0P0P0 RPP- @0,0 n_BX tX0ru\Ttt4qs, tssxtp8Tqpp$1$!0 @- MPa `0 @0_T pW 0R/ ЍA0p00s iAgA 'A|0 0   BPCP r@4 (SXMB 0lTok\0\ 0X0@-P@ MH00g_ 0R Ѝ0@?+B0kXn10!p@- PM Q  00S@_ @  }A 0S@@$0S@`@`z?` 0RЍpPh^C0$0H^1A0 0AH0$n`8 `n$np0(!l0h@-M @00S Zp  0RЍ WAW0mm808 0- M0   0R ЍyAl00 0A-M@P`P0P`0^p  0R"ЍppBB 0d^0 SS S < 0 0bA$0dmh(l\C-$MS#P3c `  0Ȝ-C2 0@*?2T p0   YAp 200S 0Sw %b"`  0S @r& @P @RPhD]\"0'< lxHklegi@-pAM1@PC0 0]!(1 0S- a`0S( pO } 0@=p 0pp000S@P P+??pA[>\=0 0R*ЍA`I>\C>\??=0?`pFP 0 @<\0@0`d8gHxhPhDh`g0 0p@-PP@M00 l`h`\ Y?P 0RЍp?AU0g`g<1804!p@-M P`$A @003?P1V\sAQ 00 R%@ 0RЍp@\\XAQ d0P0$ Ѝp?@<U@,U04Hggf`PV\ <P  0R Ѝ0PMUG?n@8FUh@$@U|0$\8feee0 0p@-M`@0@0W\  >PP?P 0 RЍp PY3@ 0R 8Ѝp@[(@ U>t0eX,ed@0@0< - 0 M   0R Ѝ>x00 0A-M@`00?p?pI|h  `0P?D00<`J< 0RЍ>$0(* @0@0< - 0 M   0R Ѝ>d0@0@ 0- M0   0R0 Ѝ>>0P|0| 0p@-PP`M00 P@ <P 0R Ѝp@; 0RЍpc>01(!0A-PpM  0p3SL x10PG \P,T1T!0   D!@a  `=P@7=@ 0P S# P00M? [ 0RЍ(00S0<SSPP @ [xPP>llGT"?PG DS,0X,`bpaaLaZDa|ZTa@-GM>d0 #LZ<[Z= 0pa%."L0ϠD`@Fhl Z0S+ q5 0`S7J0V!0R5Fߍ~Z V  @0 0 00`5>'>0 #|YhYTVZDY=밾0_``t.`4__``0P| 0- M0  `  P: 0R  Ѝ Q Q <0Tx0Pt 0- M0  X  P: 0R  Ѝ  R0e 0$ɍΌ0(0 羞 6> 0 : t0  060 P8* Q2R. P0S):p=00Sd=0p 0U4=00ISp|0,Uw -0 707 N \ 0OOPS:P& v< 0 ;P00 tT"` ET .8^58S%PJ PVP848`XT4 S500SP 8444A<080A̍L4`PD4TTSA/5p0l80(SHmk040eP0a4`LT S400Sh 4]^4\4i`EPdS\S5P  0 P+TPH8$`8 PS300S 00N8 4`'40`S $A\4PSTZS*7Pi 00? ?O4 PP}K S544P SU " 0U*(0P P| 7 0 l"  4`T0? ?O  40S0Px100SPV 4T3`aP0 RP 4PN_H{0.UL\T8T|\ RhT$ R(PUHOVVTUNt 4PMNMMMMMM+dPhPOTK)OOPNPN,LLlTK8LL4H|DH,HFFh ,BBBBBD EDD>A$ ܮ@<@l<X@@Э?@@@l;AA8:pAtA>9>8=h8(8=7X7877,;P:L6:= =t58 5:9X4@9,9$3: 3:6D2111L1ta`4Pk400aS`^R Q! R  42PQb"P` 00Q]D@=\96t2/+(Q`9P`0 QU " 0U*(0 0S `Qa`=PHQP~Q\300S+3p' 60(S# @4`940 0Q0 R:  PP@PTX\ P\88R<   T0S d t xT0S 0S   X\ 0S   \0S 0S $ {4 8tH%L 80 P`500S 00CS8 3PP; 0P4n0  P 5p0Z [  PQ3p0MW5 (R0X0CA  A 0? N?OB 1 8 J1  ,0,P 8| 50(Siy"h H8 PHPPaPR3P 50(S' 1008PP8 =P700SL 80N_H4 4p (1: S  1p P9T8 0P4 ]0p40(S( P8 P4Q2p04 (R0P0P8 O 4_0p04 (R0P(0P B3 p40(Sh) |40(S(40@p`x  0O /pX^40(S) P2pWP40(S,* OH40(SH* Q 0;40(Sx* Q; 80#3P 90_ >_O T 3PɍΌ0P POP XOR 40(SP$+ P, =Oy008Pd Ol 8 CO|;00S80e40p+ P020p30(S+  00P K30(SC4, Q > 0? ?O 1l,@ 0A 40 4 N< 0 3p03 (R00 0? ?O 1A̍-@ 0 0< 8 NL= 04 /p0b3 (R0P0PR4T9P0 NPhPH}1P B30(S . PH@gNP 4NA,4 g0V>0 Vz*( 00Ss! ?!n 3 (R0043p Pj4*0p120P&S_S S S (SD/ PU20(S`/ PM20(S |/ PE /p4M3p0(S/ P340p20(SP# P0%20(S #  @M '0 8 . dj80/0p20(S,#  M20(Sk# P0V 20 V*( 00S PPP !P ?!20  M \\\P`00 040mn T(Ÿ h Ÿ lA̍X8\C/4PPW T\L0/SD l!A 0 P ` P1A -2P408  4 d vn8 0 4d\d`P48 008`P0. .40 U8.L0Sh80 T3n8\`10(Sp  Q0 -\M10(SD  108X04,0H02؉<x-X1D-\ @- P@0M 00 0R Ѝ$0뜉0C-P @0Pp@ M` P#pP 00000` 0H0\0P0 0 Ѝ/$00h 0p@-P `M@00.0 #0 000000000H0 0P00RЍp/x0 G- 0AMP`@ 00 S0"S+ 0R?Ѝz0 @6@20 ,  0 @#@0S Pp@ @p L,,Y`/̇0t@p20 0p@-MP@`00\0$ 0RЍpJ 0R Ѝp@A>0960 I0/ 00 0- M0  P($  0R Ѝtld\TLD<4.0,000$0 0 0$0(0\0x0O-\MXŸMP@ 0PHp08|4?.xUF`$ZPR l!0P 9 0@ bP 0Kڸ! ]-PB /P!3/P!3[>|#h <<@"0p `P(,@|/ {l8P|$0R=ݍЍ0`P `E  00f/ 0  ^/Zl0l0  -@000| 4Q 004 T00 p `P $8/=.0/d/`.0.d0d 0@-M@00yT0 0 0+ 0P RЍ.넁0d0d 0@-M@00FT0 0 0}+ 0P RЍ-00@\0 p@-M@00*\PP`V  0RЍp`k` `-C딀0̕,,@0@0< - 0 M   0R Ѝ-0LL0L 00@- M<@@P!P 0R Ѝ0-0@0@0< - 0 M   0R Ѝ-H0D0@-

l00P| 0@-M@00 P fP H>P8bE 0RЍ(hk000A-M P@`p00 X   `P ` ` 0RЍ \(j0ßO- $Mp @HP`000 0S# S[ mx 00CS[k@P  0R$Ѝ[ P(%    ,     A [ W/X)  PP u P] <PP P    &  ? k g  0{ 0w 0s 0,o 0k 0 g 0 b 0^ 0Z 0V 0R s (% ရP# P v   P P e   0 `'`=j0d<1qP :qP 6qP  t 5 $w 'f0O-M @`PDp00Q0& [5 @A   (  % V:W4 }`P+ [ `C "` 0R.Ѝ@ c     [ V @ R      F B W &d00Q 0@-MP@p p`00 '  &`P  ` ` 0RЍ q&c0414!0C-M`pP00 P6W ! 'P3@ L   5 !  h0P 0 W   0R Ѝ0ZC UC &hb0ŸG- Mp@`00 P8 N%PP  0 &@C$Tv R2 tR fR WWJ << $BP#B 0RyЍpW hh PM%p #Zk WW UhP'$00"P< dd$bBi cj 9hP&'00lp qP  &p#vP $9BhP$}B%ꌐ {Ph \\$Bd%a0L,`Tt4t<Ÿ? O-M04M ?OPʍ0   *0,0&`Ps  O,@O( 0 $ :pP 0 @ Z #Z Z   "P@ Z Z -:00 0S S S yPʍ/ 0/O0 R R R  R R  R \ / 0/O 0Pb00%000%0, 0Rڍ4Ѝ0$]0d(3O- 0MP0 0 P ! C&pP$@  `   !8 P20g0`0Xn 2P P4p    05Pc^   0I44  # @pT$W 00,0 07\ &!P+  0R4Ѝ0S  X !mgA ?At:Ad@o PP<@<@a #[00 D       ŸO-"OM 0pY 0 0 41I2P `Р  0sS400 00,0 0J (PAS@ =[ 7 8@3 0[$0y0u   0p%4P*i   0U33  !" d "Q @  : 4!0R Oߍ8? ?#A9+  0ࠟ PԠ @+ 0  ;?O@UT | Z 0p0 0hh>`~!R0PnDmDm\}L}<}|Xl0P0A-M P`00E!pP@ '0P -P @  0R Ѝ@@>!O0C- M@`Pp00 `P  0J` 0RЍ[!N010p@-pM @P 0l0 P0 $`!V l 0R'pЍp0? ``===p Q=`=X=H#P 0 R0 00!N00 G- M@p`8P00 PPF U00PC  p@PD  W,%'&%$#"O" =U@@@ 0R(Ѝ 0@,  @h d@_=UD@W=   L0TA-P0 Mp`@000P c 0R ЍA  ]PU` 0RЍf^i K0G- MP`00pP+@P @ P D 0P 0RЍd</) !F "=! HJ0\1 0@-M @ MʍP`0? R0P :/0R-ڍ Ѝb pP Lc b pP P*y P*P*4 P* P,cI00 0p@-M@` 00[bl P ] kPJ 0RЍpBcG0H4@- ,@@MTp` 00@P7 PP4 ]cP jiP gb 0R"Ѝ'<p l<bbDD<b[TG0t$P <2RO-M0Ÿ4M0/  /O0` , [ !   pPV _ _O,@O(0 J :p4 *0 0@S S S J S S0S:00 0 S #S S asP0 Nb 0  2/ 0P Cb@ , 0R!ڍ4Ѝ   T P l h;@"b@ 00u;E0gth0 d0p@-M @` 00p0 Ņ0 0RЍpC0X0T 0@-M@00p  0RЍ 4C0t0 p0p@-M @P 00p0 U0 p0 0RЍpaB0X0T 0@-M@ 00p  0RЍJ L4$B0(x0 t0p@-M @`P0 0wp0 U0 0 0RЍp$A0X0T 0@-M@ 0 0p 0RЍ  40A04P0P 0p@-M@` 00e   0RЍp@0P0P 0p@-M@` 005   0RЍph@0TTp@-M @P`   0RЍp@00 0A-MP`p 000PQ'[ @p 0W00 0RЍHC:8>:(9:?0dL0L 0@-M@00P  0RЍm o3>0\0 0@- M`p 00@P P P 0E0P \9W00 0R  Ѝ 9H>0L0L 0@-M@00P  0RЍ$ &3=00 0@- MP@` 00pPQpV00 0R Ѝ9$=0L0L 0@-M@00P  0RЍ 2l<0X0@-PP 0 M`p@00 0R Ѝ@<0t0t 0@-`Q@ MP00 p 0R Ѝ@2;0l0 h00@- P M00p@@  0R Ѝ019;0X0T 0@-M@00p  0RЍg i2:0PH @- <M0@c00; 0RЍM,:00 0C- Mp00 P@PBQY`Ut ᙃ      0R  Ѝ$ 8908L0L 0@-M@00p  0RЍ1800 0A-M ` P00*p@! @AT P Up@@  0RЍL@u8<q80@l8 h880|DL0L 0@-M@00p  0RЍ1l70`010!0G-MP@0T0* @T2R0B 0QápW.X`@VP Q  / b ( 0RЍnL @80@8 @7J 70TxL0L 0@-M@00p  0RЍ61050x00p@-M P` 00c@P* Q  P  0R Ѝp R Ql7T7<7$7`50TlL0L 0@-M@00p  0RЍ0P4000@-@0 MPR016#Q00  a 00c 0 0R Ѝ030X0X 0p@-@`MP P00X0*P P SЍpX30x0x00@- MP@ 0R0 0R Ѝ0; 0R Ѝ0@q20@0 <0- M0   0R Ѝ]d200Q 0@- MpP@00* 0 S sP  0S* Q 0  Ѝ0<0`l` V  W` &0"020@\P0p@-PH 0M`@00 0R Ѝp@100p@-@0 PM`Q0   0P 0 R* 0R Ѝp0<0 P00@0@0- M 0 b   0R Ѝ/00@-0@ M p`P0lS : z0`` 0R Ѝ  L6/0L0L0@-M @00p  0RЍ//0\l 0h 0@- M@ P lR %# : 0R Ѝ06a.0h0h0@-M 0 @b Q 0 \Ѝ5H/B$.0X 0T @-M @d\a %#30QЍ&-0\0\0@-M 0 @d Qa0 \Ѝ/ <-0@0@0- M 0    0R Ѝ,0O- M  0@T`00*0p̠pP  0@S 0n00c R   0@S 0RD0H 00 ЍO  0~p,0(@(0 0A-P@M`0 P0  0RЍ0S pW0sL5 pE00p~`+0DDğ0@$ G-M@@ 0 p0 PH<' Pp3.?O0S .p3?OM~0 pG S 0004PPZp h`o5P P4P` $ 0HP@(P @Pv @T Pt@0  010E@T.p3?O @  0HP$@(PPx0S0| #@ 4@0DPAP 00S0f0S U 4U,0Raލ`!0 P 0P\ PY 0.,QR R0PL n4,UR ,Q0p岞͎pYBPTh d 0pP 0@DU:M A-t D4rUPw-8i4m/h*0hT X(0C- JMMp ` P@F00 `F4Y P x;J.?O0 S `@p @4@P#U$0RJލЍP00y 3&080 00@-PP@ M00 00P  0R Ѝ0p0P;`00P U L  0<  0=e0$0H::XD99d0` 0@-M @00n 0P RЍRЍ@T$0Cd0 `0@-M @00P 0P RЍRЍ@T#0C0 0p@-M @M041PP $0RۍЍp p xTPY3s#0\0\ 00@- M@LP0P0 (0\0  Ѝ0Wl"07/0 0@-0|P M@P0P0  0R Ѝ0;P r<cP:.-T0!0l7`A|0| 0p@-`PPM00 X00@ 0R Ѝp(00@V: \!0..00@- $M @`pP000W  P%1  S0@@9P g 0RЍPGP2>0q2w+ 0`<8<0< 0- M0   0R Ѝ|0x0x0t @- @M0p0  0R Ѝb:P(00;{00,l,h0h 0@-M@00I:P 0R Ѝ; 0RЍ@Za000 p@- `MP0U0  Q0S @  T0 0S0PR 0RЍp7(03O-MpᤁP1 8@0` < QQQ@T @ ᩟V  R>᪯W  R W,  T@`  0X$ p0,[ TPvY LvZ 0RЍOAv 0RЍ@p4 1 h02xA- q`M@PPp002 0- 0000S" *S VU``$ P X `0RЍpPU@`0S@``@```@{0O-BMQ M1@P$0$4`$ppR p$p|t P1 0  00`p E BR 100S Z;G<;;;[p =<t;9<;> ;;p/<|;: >$$0RBލ Ѝ<|;<x$R`t0$U|0|0p@-@ PM``00%1$$ @?=  0c310QЍp0l0l 0p@-M@P$`00$ P?=  0c310QЍp 000p@-MP@P`00P $$ @?=  0c310Q Ѝp 0RЍp@o600 0A-MPM@@)`p00P*9 `R !pP  Y9 0RٍЍ0 SS ,0 u03X0d82A-@00,Ÿ`MpP  00Sz p 0S p a?=0c!R34 0RSЍP ?=  0c!R3 0SP@ zP:p{W03/P 0 0R&ЍA5P`&P p P  0R ЍAX0S S  0R 0P'/ 0RЍA4 (0dx,`0` 00@- MP@00C P 9 j 0R Ѝ00H1H0@-@ P M p`0P00S 0S" 0R: Ѝ@P  ?=  0c31 P@=3R40SPP  ?=  0c310S 0R Ѝ@k3N402O-@0p M`  P0S 0SY0S50S 0s 0S( 0SF 00SQ 0Ry Ѝ F@ BY P 2 ?=  0c310SP(P  ?=  0c310S0S 0S) 2` P  ?=  0c31`0P*  ?=  0c31 0s y 0`  P  0.o00 00@- MP@@00P  0R Ѝ09F9,<0 00R Ѝ0@.y$00P 0- M  Q *Q Q``00P0Q  Ѝ(000 L0:00A-M P@@p`00e?O 0`#4s0|0a+ @T)>^?OP Z x0S0S~0S{ A+v"+c L p Y  0+Qt *JX  0$D  0$08@0X3#0O-`@pUM0L1*@[KP%P P:Q 0S 0PU7 0Q0*@0UG*L! 0RUߍ*U0 S0R~S|Y Yt Y 0@  *P@)# $$/- b0"!0:0* YW LPI  0pp@AC p@   .0X P FK p΍ƾO\Pp0 @#4s0|0 P*  0@΍0@@9 o0 @h3*eP@  $LPI o k@pD p J p d0@1@0C-@ ` M@p00 P )U$ $ ?=  0c31 0R* Ѝ0S S  0R ЍC/P\)0 00R 4 ЍC(  \0061!0G-MpP00@BQ8 lQN`  0d000 0P3:QP \ V*  P$0X  @'P 0R$  0RЍ` 0d`\)PW)@ ((K)0 08C-Pp0Q M,1@P`00H P 0R: Ѝ{P% p(0 ),@,000S00 0Rl 0 ЍC)0 00R  ЍC5. @0X8p@-M|0x@ P @`#P . p 0R Ѝp0  b( 0d0P 00@- M@00l00 Q *0QU  0R  Ѝ00Z( U( \0 0 0P@- M@`00P B\ 6̠0 S  0R ЍP-(` 0O-*80 Spp\Q 100S 0 g ppQ 0W0Wpg 0pSP u)Px x%= hF+'X D 04+.0H<P@- MQ1P`00)p@PE 0S P 0R> Ѝ0 1004 ( 0s 0S P )P)P ʌ0 S*p0 `0b0b\*L*De9@  4*40$0 XD0 0p@-MP00(`<)P' @P %40S 0S  0RЍp0@ 0P 0RЍp@P<*, ,z9 Ay*x0D̎0 0p@-MP00d(`(P@P #$&0S @ 00 0R Ѝp8 89 (E*?@*`0D 0 0p@-M@00,(`P(P U  0R Ѝp@8 89 (**뀹0X0 0p@-MP00'`x@(P T RR 0R Ѝp@H H9 8),) )ȸ0< Ԍ@- MQ1P`00'pA@P. 0S+'0 00SJ(P$ 0R Ѝ''0S0 0 3/l0` L)8 89 R()08Љ$XC-MA1@`0 0r'pPPW 0ST100S 'PQ 0RLЍC4Z'P10 @1 0IS4#'#! 1T0100S J0 3/B    '@'t  l)X X: H )됶0HL(,,؇,`00 @- M@00S 0R Ѝ&p[PP &`n'P| 0`` 0RL Ѝ@0 06:  (뀴0T,<1 pR 0RЍ븱08HqTO- LM 4a`,Z05 !p @x  @R' QU Rt R{| ! RxP S 0!0P  00 0RЍR S뤰0 pd\0@- T@MP(@  00Z 0RЍ0400@-MXT@P @ 00> 0RЍ0m븮04G- ,p$M@`0000S( P ^! Y! !#&@ @,(7,P0,0 (87( 10紀p 0RЍ  4! #[&+P PP "'X0tph$1$!0A-`PMp  00S8 00,^ @(0 R  R 0@S 0RЍP\ t  f  #L00(`0඀ᴀa0`LlL0 0A-MPp00$p@_%`$ T#3WQpP  0`l@/ 0TRЍ&&븫0؂L0L0H - 0 M,P0 0R ЍuԪ0\00C-p P`@ M0@ 0_, (%6(,pQ6,0 (01,`R ЍGt04C-@P8QM41pP`0 0#, T!Q(0儑'  1#0 0 ( 0 wppp 0R#Ѝ00, 0QЍC  lh1W (Pp ppq먩0$ȁо(X00A-p P`@M0@ 08 4548p58 0480!0`QЍD0Ѐ00| @- p M,P(`0U@0ڄ@6T200 0P( ,  Ѝ댧000| @- p M8P4`0U@0ڄ@T 00 0P4 8  Ѝp0|(`0` 00@- M@P00480 088P40R Ѝ0R\00 0C- MpP0P0c80S# ڼ`Ḁ@`0@S80S 40!RH80@S 0R  ЍC 0R( ЍC^0TX~~}`0`0@-M@ 0*R0 YP 0RЍ0S Ф00C- @ M,p W (@@T `V PUU Q ЍC0r 0R Ѝ\0ع|O-`M Pt0 000Z 0, RI(q @P 00SSP@T*  80S 4@チpP \ UPp@T '   0R 0ЍOH ' 0RЍRx0px{1!0A-M@00D""P?"pp "`"P#ʼ 0 xpW  0RЍp4` 0R ЍA 0 0M:  $08{zs,`0 C-0܀MP 0R 0 p`@p01S 0P R 0@S 0RЍ BP Zl 뤠0(O-M\ğ`T \0P 0TQ0L0 Xh$V嬠 D $p 0!0dp (0t0Hx0|4X ` 80<@$, D0]MH0@  t@0( @l dh @pptpxp|ppo d `0PP`@T|@T 0S sP 0 S+ V&  P% Q RL4 @PT`UXHP `0@S9 2 ]^H  X? U @@T`` `@ p@W(PP~"p`L 0RGЍwV0p}2T0儰q@!Pp( `p $    $8`00 P`P R 0 @T (0\\ ꘟ00yHyx8,vXvLvl3l#0hG-EMPM0T4p@P @ VPR 0:SO T+ :P p` G ` P" 04@ ]=` 00G0 `0````N 0GP}@Tx LLr pW`P= PWEVT$0RwEލЍ: P; U@ 0Tp0T0`PP) X{@T @o]M0@ 0\ ]0 0 U tzduTo0u,up tss srsdrr<1 ($`!ZX0r\r p(i|0 0p@-M@P00HU` U l` 0R Ѝp@, (0qqq8qO-4M8r@002p  0X00$ R,0P<Q`q eP=:0P0 . P .0  0ZA@ PU' Yp100S@"Z h, 0RA4Ѝ $ Wov0 =0:0V (⸠@  ( 0 P@T%T  $P ȉPP00``0<4$0 h4p8poD0@ 0@-M@00  0RЍ@r뼒00 0G-M@0@0P@@-NPU `$@P $0S 0sU$pp:` 0$ P$0S 0RЍ7l0P<808 0- M0   0R Ѝ#x0808 0- M0   0R Ѝ00808 0- M0   0R Ѝ0D0D0- M0 R0Q Ѝ렐0808 0- M0   0R ЍL0808 0- M0   0R Ѝ0@0P< 0L- M0H   0R Ѝ븏00 0p@-M`Pp@0@0P\@@-NP$P P 0RЍpl0L80 00@- MP@00P h-0S $0$S 0S 0R Ѝ0cЎ0H414!0G-`PM00A 0S 0R;ЍD/P& ,PP@@000 PpSp P 0s aT ,4P00 RP@HO ,  (0jxj0j0 0p@-PP`M00 Kt@@PP$P nP 0RЍp@@-N،0LP0P 0@-M@00LP  0RЍ(0=ŸO-@ `p 0MP@0DPH0i p3 0Wx:X 0S0Uz:@P 03/`0[s 0Pn 0S 0 LPQ PP` 0PK P 0RMЍP P, h-p- 0`/P5   0R&ЍO00 RWp# 0 0  x9l 4\0P +%<&0#뼋0hhp gg g,h0gPg,h@ŸO-@8 Mp 0<`8P0V 0U.0$Qg 0 PZV# 0RRЍ00VF 0 PP 0S$ U  0PI  0  0PS 0 0 zP0 0 mPS  xxl h\\PP0gpdf  $0P0 Ѝ5y0[03 0A-Mp`P@0`@0@PT  0 P| l00Q\0P 0 Ѝ 0R0ЍAly0k[p[j0[ 1 !0G-PPM003 )P7 ,P@@000S- pP` pPP T ,P00` R @  GPUPPT A 0RЍ P7hx0Z10!O- $M 0 0 0RK$Ѝ ` )P# q @1p00U @,PPP ?P P!U KU DRT)@ h i\e0S  +B$D4w0hYXXXtX00 0@- P M @0R0 0 0 0DS 0RTP 80 Ѝ0@ 8, u0ċZZ|Z00| @- @M 0R0  L0P0 <8 8Ѝ@9$t0HZ0L!H1H 0@-M@ 0RD{ :00ek*e{{{00 0R-{ *0:0f{ek{{00 R 00 R  0RЍ 0S 0R XЍ@0S<L s0tYY0 0G-MM*`0?P:/0R%ڍЍ ጠSP z @  *b50S PpBP (0$ 0 A;r0W0 0G-MM*P0`Pz?@ N `p"p P  *b:/0R ڍЍ(0$ 0 q0T0W <- - M,0 000p0ŸO-M p P 0 003P[ 00s03SW\ 00 0@ S 0[5 @\ aYa 00S @\ 3\` @@ X*00 R  ^-P<V2@ X: 0RWЍZ X 0 `F-P<  -P-W# 0  `` 0SW0`00 0 0` !-P W  000000 0r03uW 0``W  0  ``    , @ $DTP 0S  U:$0R BލЍ@@Q0<0<0- M 00\0 ЍO00@-P 0 Mp`00!p@ p 0 ep  0R ЍO0G-P0 M@@p00P {@`0 0PP  0RЍ P 0R ЍG\N01O-@0M00H`EPi ,QPPP000S_ @p0 ,APp0@S (T 0PU0@V; ,-Ppp000SP/ T Z kPY@ Wf'  0RЍW ,P@0SPpY sq@ N0 1 0!A-MP@ 00S 0 S $p 8P 0R(Ѝ+kP $p `@ 0@pTbP`@  Q0, ЍAXL06\6\6p@- @0 M`PS  TTP !1 @0RЍp  hbJ0>H65p@- @0 M`PS  T\ X 1 0[ @0RЍp  <6 J0`=5|50 00@-@P M00< R 0QX Ѝ0@`  0Q00 Ѝ0pI0t5\50 00@-@P Mx00 R 0QL Ѝ0@` 0R Ѝ0@ H054p@-MQ@1PP`00_100S 0 S $p 9P 0R'ЍpuP(P@ Q0l Ѝp@kP$@ Q0, Ѝp@H0t4T430 00@-@P M00 R 0QT Ѝ0@P( 0R Ѝ0@ aF0430 00@-@P M|00h R 0QP Ѝ0@i 0R  Ѝ0@6 F033p@-@QM1P`00=@PP  R000S" 0 0R%  Ѝp@0Q|Ѝp@ 0RXЍp@ 0R  Ѝp@bhE04322p@-@PM0P`00PP R000S< 0R Ѝp@^0QLЍp@b 0R(Ѝp@X,D0p2,210 00@-@P Ml00 0S  0R  Ѝ0 0R  Ѝ0@~0C01`1`0\!p@-MP@`0S 40 S  ) S  0R:Ѝpo R R 0SPvP0S 0S  0RЍp@U 0T0 0s 0  `RP !B0P1 1010!0@- MP@00S! R :R+ 0RQ  Ѝ0@q(0 0 S4 0S& 0S S  0R0 Ѝ0000Q% Ѝ0@}0 0R  ^Lg0 S 0R A0|0///@- MQ@!P1`  00S$ R RA 0RR Ѝ@" 0RD Ѝ@ R(pPw0S# 000 bY0Qt Ѝ@0Q P Ѝ@<24?0.`.̜@.x.--<08 0- M0   0R Ѝ@=02"0@-@PM P @ R 0RpЍ R! RI !00 0S, 0DQ dP0 SR4 ,00S 0s ``P p @ 00aW=000@?<0--,l,@,,+,,,pp0p 0- M0 Q   0R_ Ѝ0R ЍbU:0X0%T 00@- M@00 P  U! Ѝ0G :00 0 p@-`0MPAa0T0 1S 000AT 1S  0RЍp1S011Sa(T90S0 00@-@PP M00 $0S 8 0R Ѝ0@ 9  0R Ѝ0800 0p@-@PPM00 `jhOBS@W>[<_:a 0aR 0Ѝp@9 0RЍp@80D1D!0G-pM000`P@ A@\6 @QP0 @@@  @0@aAVAOSW[0 DbaH"a 0RЍ eg70T7QcQ(0QPà 0p@-M@P`00ڛ @}U ʖd0o00Q 0R Ѝp80!00!$0 00!/604PPO10!A- PM@0T 1 R p` ` LP ` @P R !0RލP>.?O00PsT50Od0P`0- M0 D 0\ Ѝ440|NPN\0PX 0- M0  <   0R ЍH 30NM\0PX 0- M0  <   0R ЍO D30MdM\0PX 0- M0  <   0R Ѝ] q20ML\0PX 0- M0  <   0R Ѝ T\20L|LH0H 0- M0   0R 000 ЍT<10(LP0@- @ M P@hnόQRS  U!  0R Ѝ0Ό10KxK|Pp@- p@MP`@ P ΌPP@ U`Ѝp nό00 KJp0p 0@-0h@ MP@ 00B;0 0P0 R Ѝ0@6;R Ѝ0P00JD0D0@ - 0 M   0R Ѝ/0,JD0D0@ - 0 M   0R Ѝx/0Ip@-MDAD1D@0 P0Q0 0R=Ѝp0O1SW[1S@1S' `` @ P a 0Rp000Ѝp@V_Ǿ@T  0R L1S|I/0HHD0D0@ - 0 M   0R Ѝ0-0HD0D0@ - 0 M   0R Ѝ`-0G 0 00@- M P@\ X00S 01 0R Ѝ0@lG-00G-P 0M`@00WP$ T+ T% P p$B0 0 0PP 0P  PP 0RЍ8(\,0xFh0Pd 00@- MP00 H0@$"g$ 0R Ѝ0000$D+0E\E00 C-M@` ` 00S  p p/0 WI WL 0RЍ^*0 ET0 @-0HMD@ a0W01 0RЍC*0`DL0L 0- M0   0R$00W Ѝ<+)0CP0P 0- M0   0R( 0 W Ѝ;L)0CP0 L0- M 00\$00W Ѝ!(0CL0L 0- M0   0R$00W Ѝ#(0BP0 L0- M 00\$00W Ѝ䰽 (0XBL0L 0- M0   0R$00W Ѝ䢻'0AL0L 0- M0   0R$00W ЍS`'0AP0 L0- M 00\$00W ЍxK&04Al2h"0G-`PMT00Vw <͠ 0 pzO l 1S V  0 AQ3100  Ya 4PF  0 q1S, S# d1`Qۂ0 P Ԃ SR 0  0R9Ѝ 0A a320 000!R` 1SV 0 !0` Q4P0$0xvϠ 0pN 8&04@|@L@?T??>$O-,Mup50紁00X$0 EOPU P`puW⬽T 1SY 5W׼g Ђ aq@T @ t@0("R K  0ǂ 0 {( Ḃ0 aq@ 0t@ ("W X D4PTI   T @m$0 `PS2 80uS/ WpP1S C@W|W_ػW_Wѻh W"_/ _`  Wupr3W R WIn=V@{ 0S 0S  S⯻@W 0gp 0S 0Sl\2  0SٻDB@`101SF 101S2 00 n  ዁Π v@ 0 @WP@`0SS  4R $ 0RW,Ѝ1  |x1001S $ 0RC,ЍOhWP㢼`pj` S=@`W⌼0p0 0g z  030WAw 0  3f$ 0R,ЍOPrlX>#0==<h<4;;\;::$::| 4 0$G-Mp00SnC@1SWq3 @T@ aJ c W`ӻW&@WXk @u< Wm< S@WAS⵺@WPW6  0W1@01'0W@P@ჺ 0RЍW`i0P@0eV#4Bl0HRPWϻ08"R@6T| TR0P@82<0DBT 聟`W(0  0\d`h10S 0H2 0 50DBT\1c DDr q0R  Q R (0@`\ 0 0ҹ0 H" H"`Hb_W _OW_WP_U`_⇺ W=  8"}\O0H8(876L6L5p 0 p@-0@M`@0 @,“P\P \ b,ƒP ЍpPOЍp@K40T0 P0L@- @M0[0s 0RЍ 0h3D0D 0- M0   0R0[ Ѝ䍵02D0D 0- M0   0R0[ Ѝ䴵P02L0L 0- M0   0R$00[ Ѝ002L0L 0- M0   0R$00[ Ѝ佸01P0 L0- M 00\$00[ Ѝ H40l1d0d0` 0@- @P M0[0婹U 0R 0[ Ѝ0@go0010D0D 0- M0   0R0[ Ѝ䆹XX00L0L 0- M0   0R$00[ Ѝ@080L0L 0- M0   0R$00[ Ѝ8(0/L0L 0- M0   0R$00[ Ѝڵ@0x/0 0@- MP@P0S0-`P0P S %p 0up P0S l00S↹ 0R  ЍUP P $04/.O-,Mȱ 1` 0p  0 ?B$ AO @PS׸PH 0 ?0B0Q"!\0/- b"!!R` r -:0`0 P0S S0!r  90S0!H+c $ 0R,ЍU0.0---,1,0(!@-AM@ M0P R 00@ $0R3Aލ Ѝ@Ѝ/`C΍0 [0pS $00W[LdP GP 00WWI(WD0+h+|=-@-AMPM0P@(0@ 0R 4 `pB΍0  p000S GW pt)<WгW$W0*hLL<P@- ` M@p P00% P! T 0SW 0S t0000B`0O⶷P*L0@Oⰷ 0R`, Ѝ }wd0d)L)4)O-LM⸻+ ˟  (˟ ,˟ ;˟匫匋 D 00S 0,bVsAT  P6Eτ4pP= P$`U  R  R 4"R  8U}Q0j8` 0 O<0K<$ 0P?:U- 0S 0S$0dj `[⭶0 0O8 0p 0<O◷0S 0S i`O $tP \> 7l4"(D 0R,LЍO PO⿷7?0@ @@R``OPP:OV 0SO⦷fP P [6[FpO唷0 O2[ⅷ`[ⷶ@nfa`["[⫶T[p@D{7V[K1SrϠ [ 0 0@s0Sp P $P P~70[в@ hKpP$P4@W 4"R/Of P]:g`[[ѵ0 0O 0pp 0 [7? 0@44APO家04"0l080$0S ($$p 0  & 7l 4"9 [∵@PO׶8p0 <Ou \$ 5 @10101S 101ST500 * 4b]`f{r  0 [0 ᣶PUD@[D[z4\ 0STP[p@0Ds0ST 4T0 T@D 4"!T񏐩$LD[ C@[P l[[^ [SP`[ұ01SP@ VPP0@ A([⸱@,2O\PT0O 0`+60/ @044AP[⫴00420O⳵< 74"U+0[p[( 0,$0Oa  0 y, $ 2@_n[_[gP_˵`_ [⳴1!R=0:_S[_[L@_ⰵ`_ [☴C<41@*0  cp밴 d0(((|(t('P'&l$L#"X"!|!!Xx  HHdT$O-M M\c\ß? `P?OL#  4C D$͍,@$0 ß?B: ŸD  P[2000S`0@PS~!P| Vp0 ?0B0Q"!.0/- b"!!Rځ  O4 Ho pJoOJ r -  5.0 0IP.N0S S o poO ͍0S& -  0p*嬠P < u0!r J.5 0S0!SmLf [óP| E4 W$D 0R ݍ Ѝ@|v04(X 8 l l<0< 0- M0   0R ЍVH0\0\ 00@- M@P00U 0R Ѝ0 A;0P0P0L @- @M0S0X 0RЍ"0tt0t 0@-M@SP 0R0 <P#3 0RЍ2 P#3 0G-Ma1`0P @  vϠ@SR:z?  ͠@SR:1S B@%3T]0<@-Mh dp`X0 Pp z80@aq3 0RЍ;08\0\\ 00@- @ M0 R1 P2 0`PR Ѝ00H0D0@ - 0 M   0R Ѝ0pH0D0@ - 0 M   0R Ѝ0D0D0@ - 0 M O  0R Ѝ`0D0D0@ - 0 M S  0R Ѝ0dH0lD0@ - 0 M   0R Ѝ0$1P !00@- M@P00 1P. 1S( 00UP!0Q ( Ѝ0@0 0R00 Ѝ0@ 0R Ѝ0@#1SD00 R 1S1S_P0 t (   p0p p@-0h@MP`@ 00E0`A0`0 0RЍp:0\ p@-M@@0P O00 0P`P O OO⦯SP@ @0  % 0RЍp x0` G- 0DAM,4P@`p0 4 P @ 0+iP x+P $0RAލP P |c`P `\30KPV PaPT  `@P @ T /d p0S A>@04D0Si  B@P a bR$R_ 0S S  0S SA> Bd+@$TH䁟`PSm(NPA 0c tFln Q5/ Fg 5/ G` 5/ HY Q5/ IR 5/ JK Q5/ KD 5/ Z= 5/ [60 05/ \- Q5/ ]& 5/ 0 S$sP ᦫ L 0R#TЍ0ZPy{  p|zP#NP ၫA$KK0 O-\MJ:@*000T0p0S 3PT 0R\Ѝl:`P p} D:@0 04:00,:00P;50+&! /+*)'&%$#"! y     h_VMD;2) [K~}|{ 0[   >x@&  p  /x@  p  5/ 0@P<< 05/ 0@P<< 05/ 0@P0000 05/ 0@P 0 0 05/0@P 0 005/0@P0005/0@P0005/0@P0005/0@P0005/0@P0005/$0@P99$05/$0@P;;$05/$0@P<<$05/$0@P99$05/$0@P<<$05/$0@P00$05/$0@P@0@0$05/$0@P 0 0$0}5/$0@P00$0u5/$0@P00$0m5/$0@P00$0e5/$0@P00$0]5/$0@P00$0U5/0@P::0M5/0@P::0E5/0@P;;0=5/0@P;;055/0@P<<0-5/0@P<<0%5/0@P0005/0@P@0@005/0@P 0 00 5/0@P0005/0@P0005/0@P0005/@65/@85/@75/@55/@35/@25/@15/@95/@45/@-5/@,5/@+5/@*5/@)  R K~R# KR+@x  p/|R 0 r]0`P|@XcyL 0 [F0X0H@@ ld0d 00@-PP@ M00 ^P  0R Ѝ0nol0X80PQ 0p@-M`@P00 nTP  0RЍpE(FC@000@-P 0 M`pT00 mUW P  0R Ѝ( |0\0\ 0@- M@p00Pu `d 0R Ѝ0-0@-Mlh@P 0 @P 0S  0RЍ0@ Ѝ/<0QP@- @ M0P R @ T@p `@p `@@\ \  0R Ѝ@P    0D1P@0C-P,M 0@0 000$00 0@8  0 pP3@T0 `V- U  0S SY 0 0 000о$ 0R ,ЍpƾY000p20H1@-P@0 MU@`p008 U  0R> ЍQV  ѿU UTP*F00 @DS  TPT  R @d1 D4O@TP Q @d0D4O@ 0d0 1A-`0p8M@P\040p  p  p 1 R S 4 0R!8ЍR R0  Q0S00 R0 R 2/3?R 0\2PXŸ0O-M @00 d`@  c?Pz/Po P0 0 0Spj 00SfPd p^ U^ \H \  0R\ЍW `4P  p 3S/ S00@ 0S   Lip 4S SH0X0 RST  0Yp  W80080P0S  |p\ p \pp01!0O-`P LM@0 D0 _PG־PS ,p 0 0 ,P@@ !0RPsPU R3  4p/ PV  PUT V P T5 D 0RLЍP L , ;ꇿx0X,P2"0O-pP LM@0 D0 PMeP p б`́1 @00U0 @,ePPP0S8 ?1P<Z   `, p4 p9 p3WP  WP`U 弼D 0R+LЍ 5`  |`0``L`0p$DTx00O-P( M@ P@D T  `S! p  g4/p P?0  0RЍ2 R R 0 ŽV0Yp 9/p 0 ꞾT0@-M<8@@ 0RЍ舾 0O-@QM1MPp T `@D00 P00: 0RfڍЍJ!:  ᘻp!? ?O0W00T10S P  7/p P 00嵿0S S P HT0SP0\ @T0lS P00S T S c00Y 9/p00T 0@-M<8@@ m 0RЍ0l0hh 00@- MP00|@2@0P. 0 0Q(0`0 Ѝ0νP00 @-0M@p`0 S S  @0 S S 00Cs0 S@P00Es0 S0@P0 Er R008PP@ 0RЍ蔽ؿ00 0p@-M@`00λPP T 0 Ž 0RЍp#p0401|!0p@-M`P00 U0 @P 0 000@ H4%0SI6 PP: NP, JP( PPPEU 0RЍpG PP 4P  0P ,P (P PPPEU4, X0pl000p@-M@P 0R00"I  0R(Ѝp PP`P `P, `߾P `ھP `վP( PоP$ļ뼼0D0D 00@- M@00KP 0R Ѝ0讼밻01!00@-@PP M009  Q2! '$!(P 00AQP $00 0R Ѝ0@ P 800 P Y0 0mjd\0D 0 0p@-M`P00ġ@¡P $0S@ (0@ع$0S(ӹ`P  0RЍp@ǹ6,02QP"0A-M@P`00 0ASd/+,0PQ01I$ 0S R ˼P`  0RuЍ0 CR001H] P 0S P P pPP NK ϸPCP0 ᵽP. c0S  R rP 0kp3 0cP 0\P 0Up34ꍻ t0ط 1QP!0C- M@P`00 0 S  0R, Ѝ0CSp0w03 x 3 ᆡსYIFy _P 0R ЍC<뤶00 p@-0PM@P`0V0  0R!ЍppP `t0 0 d0P sphpap` 00됵0XLT0T 0@-M@00P 0 0RЍ먴04l0l 0- M0 R DR 0R Ѝ Ǻ<0DD 0 0- M0Q0 `000R0  r8 0R Ѝꟺ봳000 0@-M t0@0@0 r Q R P( 0RЍv00 0- M 0A S|0 00 r Q R P< 0R Ѝ?t0ȥ<0 0@- Mp`@P@0@0Q ᅻP 0S᜷P @ Pu8 P. 0R Ѝ똱0 x0 0@- Mp`P0PP0 TTQ QP P@tH D 0R Ѝ @޹԰0\0 0G-`M@P @0@0P Upp`  P@ 0s 0RЍ諹0\0 PX 0- M0   "P  P 0R Ѝ䏹H0G-lQMh`dP ,0 pZP@ 0R>Ѝ謸P: @t$Ꮉ@t ᵺPP&  YP`` <`㌹ ]P tI@\\ <lDD<820<3Ȯ0\ X(2"0C-M`@ p00PTQ10J$  WG 2WS  WO 00pԺPH   0PQ ݸP TCX3 P8 @P3  0'P8  @0R"ЍpP0 tP&pT럸Tppp``p80|tx/`<H|0P771!0@-@` M0P0Z00#I4HR 0P0姹PpR 僶PE00CS 0R7 ЍK0 PP  0P) 0  P P 0P 0P 0ٹP@88((X0`41A-`0@MPP00 }00pW7 @@@`ʞ ᳝P` @⩝ᷞ P⠝!!00 P ####`P <`$  R$ R 0RЍ$4$0S( `((0`$0S <T0@1!0A-pPPM000 0S 0R2Ѝ`P% ,lP@@000S` P P T ,XP00` R @Pд$lȴ5똦0T@- @ MP p@E\```̠I $ P U p Ѝ@"P U p Ѝ@F$P U p Ѝ@m!0 0R Ѝt0R@- @ M `@' PE\p̠I $ P U ` Ѝ@9#P U ` Ѝ@$P U ` Ѝ@!0s 0R Ѝ軶뀤02"0@- M`P00H 0 @   000Q[GF@=PpP 7PO 0R@ ЍVPp 7 0 P  0 pP 0 pP 0 P P\g뷵Pp 0P 0PPDC=8?0<(9 6눣080 0@-M@0Q001I H  0R Ѝ0 0 P0dP0PL 0- M0   @P 0R Ѝ딠0l0 @h0- M0R   0R ЍƵ40<1 ^ \ R08!p @=31 0R9ЍP a  0'0P 0P/P Ph00``HHaꀌ0@|ؒ܋Ĉp<4G-@0 PMpR0L0' 00CS40AS  0hȕ4 00 r \ R Q,d  gG0AS  ?0AS񏐯P _L 0RPЍP:`kP+ #00CS! " 3`$0S P(0 P`$0S ƖP   4##P@ⴖ`@ ܒ0 CR PP⥖`Pו ͒00CS  Œ  归 $剖P引0 VPP] 媒y 0 6 02 0. 0*0%0!vL=D1Q00Q0  r! P _۔ ٬A Q 000Q0  r  P_& P_尔dP`_0(}0xydHty\ỹ؍y̍th000@- M@P00P  P 0  PR  Ѝ0@ެR Ѝ0@R Ѝ0@^ b봄0x3#0O-M P0 0@P gۮ1PbPv᦬P ᢬P ឬ`P ᚬP  ᪮P@ 0eP gpdWY _p\WbۯpP `0@ ㎫PݫP& ჭP 1P" ,PPO j  0RSЍPpgPgPgPpg Pp\ pg?H0 Pp  pg? 0Pgg g ggggg0hH@(h\̋@$ԁ ~~~~؊p9p)0O-|M TP0 t0  ᝓKP t0@@SP `0D S񏐤f> `8`8s#`@̏P `VP ԮP  ɮpP   !p P*P= f? 0@ )p 0#p 0p 0phpp@0@pi 0pc pp0ISId`Yo  Y0P0 ⎎PL塏P <CP 0ⶎP&8⯎P@0P$J Y ȏPF P DP, 0H4P(0 00AS < 嫒0$0STP  $(}(0$ ($ؒP7$@ @≒$@ 兒|P wP ῒPP PpP l bP ]P ᥒP0,D00P` `0 CRH  W04 0 n(_P P pm $|x(m,᧑ ǩ$ũé,(忩xO XPT5 ᶩ崩W %጑t 0R|Ѝ `nɍP $ @P@p P?PX  @ラ8,(mmm$pzupppkmcvt_oh pZjXTmRe$XV,(mEXꓫS !  S  q  m-@ m!4ro0x4xxx<dvv\vllԂuĂuhuj$xuDjt(L5%0O-P Mp@0 0 Qyo 0P 00@`Y 010.-00 Cr R @A@00@D0Cq QT 02P 0,P 0T 0RЍP 00 V  @R R` Vë뀰 P  ~ P  W[ VY   V0Sy0AS YbP F000AS  Q P T000AS Q  P i 0  00AS Q P 00 0 S S @0 S S  S 0 R @ @V4 O4pU7E > ~70 -N(I# ៧h<X7H u0 `Ԁ`<`1!0C- MpP00!@PO ̧`PC ȧP? L שPKԨ뛪ᘪY0 ѨP5 Ĩ~PP] 0R  ЍP[P㫨ro ?0Jtt☿뒩``⑿PP⋿@@ⅿdp0m\m~`m8xDmo,mXymxp@- |@`x0@pMP00.X000S  0RЍp@UOdn0H0 D0- M 00\ Ѝ6m0P0P0L -  M0B/S 0R Ѝxm0p0Pl0@-M 00 P H@0@@1P  Q* 0RЍm0@0@0< - 0 M   0R Ѝl000C- M Pᜀ@p000@S1S  3/T 0SU RP 0R Ѝ붨 Z  0R8ЍP) ,㪩P@@000S Pp P T ,㗩P00p R P@PL, 0 mg0yy0 00@- MP@00WTPʄL08H0ڌL00L0դ 0R  Ѝ04 40 $82Pf0dypytyypq010!0A-`PpM006 L@*(H@FP7 P@T  3>@/  L0Q0L0Ѝ 0R LЍA 0R,ЍAߦTe0x,xwx  7O-dMP 0400\0U T8`8T @᥌@T @bG@TFP\L0G (yXu R @AP 0$0%& 6  0( 80H%5 @P P0, 00<D @`VU 0p`$  PI PA Z2 >P  0 q P (圧P01 8啧P01 H厧P 00V,P X 0<0 1U 0P@DP` @P 0 0 03/ P0T00@P P ᄣ0 X ^1@^30 ^ 1 0^1^1 ^0! 01S01S0% 5Q= 7 5 Q10S 3/4\ 0RydЍU ` 0`$ pL $0 1L0$0L Q0Pk  0 0P`l"  00,0 $0 0 J@b`0s`p,0s) ,㓧,Pp0AዧPpAԦP  1 00~8xw0$`PpPX@!@>1 0NH$JGCL <` 0`$ p2.+ '  }  d00xy0@ S S! 0 S S  S 0 \  008`ᴜ 0R ЍE0P1O-@H!0 MT`p00;P0 7pP, N P@F@T ᵟ? B3cCcES @⪟T0 :NF 0C3aCdET 0R ЍOc 㓟 0R0  ЍO茟žE0p`  0- MS  S S  S S 0S 0R Ѝ00ꜞC00 0@- M P`00k@P{+_p@  0R Ѝppॻp勜 Dޟp停 ]] C0`_`__0 0@- M `p00(PPK A+p@@  0R Ѝhb꥟@H @ֺꛟ? B0P_^T^^t0 pp 00@- M@P00  0R Ѝ0@裟xP  0R Ѝ0@@0A- M P `p@0`Wp# 0S   `0=p  0RЍ\ݺ:ޛ<m2֛ ೺곝x@0^]]X]414!0C- Mp`@0T09 ќPP "X =X/ ܀00TPP0=S  0R Ѝk ៜၟP `00P5PP@d$00P`?0l]k$kj0 0p@-M`P00@C@=00 0 063 0RЍp0>0` \0p@-M `OP@@0 S0RЍp\=01!0C-`QPM@@00 10:p P& @@ႚ p 0RЍhaP !0 0 00A@0Sd Ϝ<0ll1l!0O- Mp@P008TP5 0S2 Ꝡ、 @@ᮠ HR! 0R0@0PS6   20T "R P@@ WR# mR dR hRDR!@r 0R ЍMR SR `sR wRo;0 QQ0 @-M @  t  ྜP X 0RЍGKeIT:0lXxXX 1 !0p@-`PPM007 @T2 0[S' S :S /S :S /S 0S 0/S :S S0 0RЍp00]P 090l0l00@- MP@ 0[R0  0R  Ѝ0ќ0@ ]R  ۛ80  - M0 :S * [S | S:S /S 0S @S ]S0:SR  0R ЍR 0 S0[S ꠛ80-p@-M(P@ 0$ ` Ip PP P 00UP G0 "!0 0RЍp@ Ѝ/nh 70T -p@-M$`P 0 @` p  R0ۘ0 0RЍp@Ѝ/ B<=,60HTTT0 0p@-P`M0P0 0S @@ⱘ S0000 0RЍp|50d1d!0C-pPM0~Q06@/ `PP.pdW:  0*0p00GP/ pӛP 0P/S 00Y@ @ P 0RЍ4PPȰD00꿚80ྰ(ະ40(2̧Sp`SRR-xDOO-8BMM0*C͍B @_  @ lQ Qg @ T0 B x??ORT0B//OS   3 `0  S p: 0PS' %Sp`%W Tp [ UP  *p< P*[:PP < p, :l/0RBݍЍOЍ/HH'<<"00P30lQTNQNPMPMO-@ M쐟쀟p 0 0`0P0 ᰚP 0S 000ٚ0P S 0P  0ݶǗ P #P  0R Ѝ̙00xMP808 0- M0   0R ЍD긙/0@- Ma1` p00DpP* @@T |Pp00@ 寗  0$㡗U 0R ЍR Ѝ@w@00@哗0  0ㅗmx/03 ON0Q 0G-M@0 0 ``Xp xP 0 @ ;T 0RЍ15D.0@MO-M`p `@`<X`P@`ppL T  0 xhQ(\DЍ`-0T0T0- M 0    0R Ѝ,0@0@0- M 0    0R ЍϘ0,0ll @- M"̠#l#X#D"x0`P@0 "$\p  Ѝ谘+0P0!ĠL 00@- M0!\!H P  @0R Ѝ0蘘`+0@0!Ġ< 0- M0   0R Ѝ䄘+00 0@-M@`P0 00 0Q=9BbA =B`b@B,/O C3G0" 0\ЍZ*0bAT 0@-O1HP ? M LdPaP \0 Ѝ0>)00 0@-0PM@P 0R 0⫗P C<T00㌙ 0RЍ0)0\DId@- X` M@P p !0pA0 0$R ,( Ѝ(02"0C--`pM 0P0$0Sw !A 0!SR* 0RЍ(, $0(0c S,0b=9(H =(,0XY qNE A'JE A{ QE0@" @@PnE@"0 @ fEY$ J 00S( , h(n,^=鎲L 펲(,\* ! 0b SR!-:?P @0S'p 0 !㺔 ᶔ,0S 7^! 0!SR,0R00ñQ .A(00 0p@-`PM@0 0"0P 00  -P0#03P0S d  P@3@#O 0RЍp$$$%0 FFEAE0 0@-`Pp M00% P@P@Q tPt00A   {0S 00S P# 0R Ѝܖ$0pE\0(P 00@-M@0 0 000 R P`P\0PP ᯗ 0RЍ0꫖$0>P$D0 p@-0M`@P4$0 0ij 0 ) p 0R Ѝp坔,z<#0?CC d1 `0O-PLM 0D`@p   0 4 80<0 0$00@`00PD( ,4 0 PPb 0 r  R ߗp@ PD 0RLЍHP 0DԲ4 0̲x"0CCBCBB G-PࠑHMq0   ` 0  0$0p10P 040D (0, e PP!    p@ P!,0 S( R 0S  D 0R%HЍ  p|| hd ` _H D V꣕ 0hBBhAA@AAAA@AO-@RMPp00嬓T 0S 0SS S`ᘒ  T` " ሒd@ @'Tw 000B 0Qá)`BQaZV00\,j,0004080<0@0D0H0L0P0#(f\10P Y(00XP (LP@ @\  0P 0R2Ѝ@kzTx ( 6x:{YX` {  ΕkzXP਱H  Pࡱɓ(P00-??>O-@RMP`ᨐ0|0T 0S 0SS Syx20Phpz zwP8Ph> +wPz`zV d(Qqѕ`Pq Pd P`  pP]  jPW D$P ᝑ  ŕ  pjA.XF 0 TĆ PĆ0X 0F>0 DThh$E?x tpGG   0@P@GO  0*WJ^P 0 0 0  @ 0 00pW M @ 0 P!0Riߍڂ0dşd5O- dM4< 0@0 Q0\0QQp80;@G>PQP;`!Ƞ X(D/00,0,B唄夔 !/@0P$ 0堄D1#0嘀% 0$0 $D@0PdI,B喁,؁@ P 0! A !,?  0 0 SR 8 p4Ą8 (2/ ZXxTMFn 0 <@TċPċċ0$SP<PS M.@4( ᢀQ4p@@\ @0# " 0QdЍH@# V<`$QMN@HD/0p!Ƞ hh唌T唤D ` a0 td, #BP!!@Pěh0p` p,0@P` p!"" 0 0SR dp40E &2/ p d%ȠP pత$( `a(t 0   ଔ༄A!@P吃(0,aě@Pb `,p p` p@!"P" 0 0SR d40 &2/ &}0lO- dA$M4`@ \@1 SS 3 0 S:R1 YJP p ;@JA4{;4 ZI)5 IY@ 0R$Ѝ  4 Д y* Kb  d(4@D0ß2O-P`M؀ l@ex D0С || 0p$@t,( ,p<pH48@ 0 08 4H Lp 0@`<0,t@< 840 @  P  `0@L 0`0ᙡL@  ` 喡ᒬ $pؠᓢ, <0 (  ppaj0 a pjC.IΠx  0    tt>pt TDT 0  0IpK W  0 GO >M3WgwύP$4@ 0%5 %5 %$5(,0%458<@%D5HLP% T5~ 0@q+T U^P 0 k"0Rߍ}0tǟt7O- tM0@ 0hD0 Q0l0QQK~0p@<4; 0QP;<@!Ƞ X( 0hD ,唌B`d$ P@ ܔ喁!8䔓 喀d%씓$0$$@ 80PI,B喁,؁@ P 0! A !,?  0 0 SR X 4Z (p2/ 4dp`0"@%͑!@'́eWV 101f @3WV*i 0"@`epagbe<8@bfcᚍ[0 ,␍AU"[9 ![bA }RA zR ؀PI[  v"[ SA4W@AgV ]Sh@PIWVH@P` p^'H@P'& 0G$UHTIH 0'́@'P`p@gP`pYH`p@P=H@P` p6@0SVpfP`P  Sm@PVP ~SV@V R`V fp耍E`p @pX@`@P㴠P$  ZS R V U0PA/ yp X!P׌ !RU  嚼P@%m#mT@!0R%Gߍ蜠ඌAU`PUP0SDAop@ ᣌRPPAUP@pW mATTRNV@U wR@ @T@T@`V pUPTP @T?R`0SCpS@P@ ^PR`PPUP ^&qPQ @A 0J>Q J@RPUT:HP( @P`Јp@P UT flP @"[ hp hA@P  0@P QUT"#zRAU@AU Qk@{dA@5T.3p@W\RU@T Qr@cAfSl뜠eg 0 l`e\agbe8@l$ `008 PcSHS eR(8$` \0 `,,E?X夠L P0(TpRP. f-PPl@OPP Lf H LR l Rf0AS%hPS h P RP{ N@P f0Sh R P$`(= t 8 Q tfO@P aOP t岾pP H7gx<0D@0 RP g OPk tGO@Pf Q t ERP@g 匉g 0ASoMx  NPNG 0@PO nRP N@P;  NPqi \RP QOP PRPO @$`P(ʈ`h l@P$`(弈RP$`(岈H$`P(Dp@lPE⥈Fi ]QU @$`(P/@P@P@$`P(刈@$`$@y(@ 卩PPEj$`(,@"QPdd$`E(ZH@DP$`(O$`0(PTp@X\S * MPP ߮@0 %00Y  RP@ @P p~mPf -MPW ?PPR 5lPD ?@x P| #G@PG#UT'*0 ( 0d  DmP G( 0 P  P$`E(@㇮mi,PPu gi WQP T@PӇ,@ P<$`E(ɇ  P$`E(忇 @PEⶇ LP LPH(@P @PE⛇ P|$`E(呇@P0$ U0#02S A0S*P NP0TJPu @P`n@Ѐ0t`HijP`Į|<L@8(Э\hȫثDd(d Ȫ1!0A-pP`M@00* jp@: PO GP" ci  0YP!O0S/  Jm@@T@# 0R$Ѝ@iO@Ox@kRh TL݆@ <@JV"jr0,L`Шhlt Qp @-M @   T0  "Sr ! " 0RЍiq0(0O-@0P$MT`00-* p 0+ 0@T* lkP  @ T:{3 0R$Ѝi|p02Q"O-0,M` 0 $0"1 0 0R*@AT:XRPP} Rk:08SpVP1&*PU#*V*@@T* kP P ıA 0@ 0 0 &h 0V:$ 0RT,Ѝp1P000@0U0p0pG jP  @ Q 0PⰐU:000 S 5P0   00@x000S@d㬦P0P 0 @vi8 xo0}Њ8|(Љ{܈tzl0h 0@-M@ 00|iP  40P0 Ѝ?i~hl0Ĩd0`0\ @- @M 0R0 Si 0RЍhl0p0p 0@-`Qp MP00 @@T   0R Ѝhk0|0Px 0p@-M`P00 U@e`@T 0RЍpwhk0l1l!0G-MM*@ P0?e<0 Wi@ P4*$gpP0 IOfP P e* 0U` 0S0p?0S PzeP /gfP0f:/0RڍЍhPP\U@gThj0xp@- p M0`P@  xeP 0 0 0R Ѝpgi0D0D 0- M  Q 0 Ѝۥgxh0L804 0- M0   0R Ѝgh000@-IM @P `01Zhp P p sfbiV 02P0Ehp !0RIߍgg0H0H 0@-M@00ehe 0RЍ@ggg0LH1 O-4Mp@P@!0,afp` , 0R'4Ѝ `  .h< (hz f  0dP @ 05f` >fAgh[e< 4=}hRe  5}f0@\808 0- M0   0R ЍegTe0H0H00@- M@!00se 0PPR Ѝ0g e0QO- AM@@ _@SAp` $,@'S?pHPQ`PZp A , '@?p3 ` Q p pQ Q@Pp P, QSr:Q =`=V03107: 0RЍ`fd0l|2O-0t$Ml"lr@  `2` P0 0p0 8"  Z("0  # f  =Z_ ohPP T&.V UE*0 cP@ ZT76VP  X/0c@P@V+ U!*0@cVP  X 0c@P@00  0SV 0S  0R$Ѝ@ 0T񏐸S0S  =S0 eb0Пܟ3#O-0$Mp 0 0 cf pp0 p-W0q0+W p  SR X@pX:p`  TX X' X pWb0 t 0R'|Ѝ -`p0b0S 0  bP b00S0 [a0P`pb 0 aN0@0@ 0- M0   0R Ѝ{ aM0<0< 0- M0   0R Ѝh`L0P0 L00@- M @P00Y 0PR Ѝ0`xL01G-0 ?`PM@PpPↁ!0R 0 00"R "._P AP L^Z _ 0RЍPY D@0 @ a ` L0ggpgf1G-0!?`PM@Pp_ↁ!0R 0 00$$R $$^P AP ^Z d_ 0RЍPY LH0@  Oa$P`J0fxfeoeD0@0< - 0 M 0R Ѝ6`I0iO-eM MƟR@ &0 0L< 0X T6 c|0 0pƟ 4dƟ \\Ɵ PTƟ T@S0\ @wPZύ$a6 ͍$ ͍00p`A` ύ `}?ύ B΍0(` {` w`K΍  S΍ n`( j` f` b`,d< P}^< pPx^P4X0Sy T0Sv 0\ @0`L 00 +) P:PA~pG0P+X0P* 0 PPa 0[]@0aL`0R0@- M p`B00' \) @P@U V0`` R @T R P@ B@0Ta  0R  Ѝ`g^0 `t]h?0@-R@M0@@00 B0  R  P  Ra @\Ѝ0 RK]h>0":Ÿ S - M  X S  Sb  S 0?    r-00w-!-@Rq [ Rj ! Rs  0   r-00w-$ RQ > RJ Rs  0  r-00w-" R1 ! RB Rt  0   0RJ Ѝ S>  S  Sp 0 d 0 s 0 R-  0R-  0R-  0x 0 CS 0 Cx 0 CS 0 Cx 0 CT 0 C- 0 rl 0 nc 0 jb 0 f\=0O-@lPda`q4M` pإ`p,]Z0p`0pp0X0!$  Sp`, 0R-4Ѝ  Z0Y 0SQP P0 1QP Z0(p0p0 "R UT p00"S9\H:0lR0@- `P MP @0 P ,0 0R Ѝ0\90ßA-@ PM Tp`   *T?Tx \0 0S7 TC  T?  T; %: T7543210r('&%$#"! e0D TS0\T@0@@0  0RЍ@00 S  " ?T*T #T[Tt0@0@#300000\ @  \t00 0S[T#T@\  `M  @`\t00 0 T^0@@0? 0 0@0-  @0\r  0\s  0H\00 0x X ƕ00 ƕ0\a  0\b  0\t  0\n  0\v  0\f  *[90|0|0@-@ ` MpP0Q0 0 Qpg0 00R Ѝp[L50O- k[0 0S<[ ZE 0S Z@ Q Z;  R 0J ZS'P[0 0S!,0  l0YF:  @[`PpZ T**Z?Z  \Z0 QY)@@@ 0 R  Y *Q ,`p 0dQf@$04 c0R<Ѝ 0hZ40G- PM 0Xp00@` @\07THp 0/0 0j0RЍX :Z<20<0< 0- M0   0R ЍIZ'Z100 0@-pP Mp@` @@ 00S 0P /\P@ 0R ЍZ@10p@-`AM1@P0 0#wQ/ 6/000S 000S P @P gW 0RЍpPQ p6/hP\6/@@H@8Y00ppo`p(o\ohP\D\0ŸA- (@R M`pP  R8 $XPUV 0S3T P@ 0ReЍ0W`PG VFXP>V@XP6PgvZ@P6RZPZq[ XP00!YP0WP YhV5ZV7XR[0S@0@0$ZE[@Z00ZZZyV@X3[uYH/0nxm@0@ 0- M0   0R ЍY-08C-DMDğp@ P <9P $(1 `V x4Pl< 0R DЍPP v VP3 @`` <wuUVSVP OVT ZXYP0S 00XP 0P Y P Yppu  0WP@8300SX (300S@Z  R 0SQ 0S 00/YpA Pru0P0S 0S  Q  0Su` XX0XOu$00 ; 0WP$0i t 0S *YXp g@3n@0 VPW$U@PP X$Y`V+ Q( uYP$h!  ``< uXp P88tQ$$n0 t< mm 0 8P  tWmm,0,k ljmC S>C S=C  S=C S*(P H0*PH,`   ' z Ȍ [B* [ B k [:@@R@@T00 0A@-b 0SO-` MPp@6RC?oS cC0s$Xto '8P I*PI`wpY` Z@0F*Z`F ` ЍS`oW>SR!```R2@?oSlPd$t`' '8P I*PI`wp P  Z@0E~*ZPE{  Ѝ g2!56W( x  @ j%ȠP De:@` uP  V Z KM:0jCZ:00T``V| `@ ЍC c5)6$s t+ )8P0K+*PK'P`y`U0F*U`F`Pe ha`>pPZKP@DC-pL`HP`LP`eFaPE@@0 3/T/0 00S  Ol`@-sshd_hostkey_signrecv_rexec_statesend_rexec_statecleanup_exitprivsep_preauthTimeout before authentication for %snew Generating %s%d bit RSA key.RSA key generation complete.%s: key_sign failed%s: pubkey_sign failed%s: ssh_agent_sign failed%s: entering fd = %d%s: ssh_msg_recv failed%s: rexec version mismatch%s: done%s: entering fd = %d config len %d%s: ssh_msg_send failedReceived SIGHUP; restarting.RESTART FAILED: av[0]='%.100s', error: %.100s.select: %.100sReceived signal %d; terminating.accept: %.100sdrop connection #%ddrop_connection: p %d, r %dreexec socketpair: %sServer will not fork when running in debugging mode.Forked child %ld.do_connection: %s: server_key %d < host_key %d + SSH_KEY_BITS_RESERVED %ddo_connection: %s: host_key %d < server_key %d + SSH_KEY_BITS_RESERVED %dKilling privsep child %d%s: kill(%d): %srexecOpenSSH_6.3p1-FC-0.9.3-7.5.fc20OpenSSH_6.3 /etc/system-fipsFIPS integrity verification test failed.setgroups(): %.200stoo many host certificates. too many ports. Bad port number. Invalid login grace time. Invalid key regeneration interval. too many host keys. Invalid utmp length. command-line%s, %s OpenSSH_6.3p1usage: sshd [-46DdeiqTt] [-b bits] [-C connection_spec] [-c host_cert_file] [-E log_file] [-f config_file] [-g login_grace_time] [-h host_key_file] [-k key_gen_time] [-o option] [-p port] [-u len] f:p:b:k:h:g:u:o:C:dDeE:iqrtQRT46sshd re-exec requires execution with an absolute pathKRB5CCNAMEuser, host and addr are all required when testing Match configsConfig test connection parameter (-C) provided without test mode (-T)WARNING: 'UsePAM no' is not supported in Fedora and may cause several problems.noneAuthorizedKeysCommand set without AuthorizedKeysCommandUserAuthenticationMethods is not supported with SSH protocol 1AuthenticationMethods cannot be satisfied by enabled authentication methodsExtra argument %s. sshd version %s, %ssshdPrivilege separation user %s does not existSSH_AUTH_SOCKwill rely on agent for hostkey %sCould not load host key: %sprivate host key: #%d type %d %sDisabling protocol version 1. Not allowed in the FIPS mode.Disabling protocol version 1. Could not load host keysshd: no hostkeys available -- exiting.Could not load host certificate: %sCertificate file is not a certificate: %sNo matching private key for certificate: %shost certificate: #%d type %d %sBad server key size. Forcing server key to %d bits to make it differ from host key./var/empty/sshdMissing privilege separation directory: %s%s must be owned by root and not group or world-writable.setgroups() failed: %.200srexec_argv[%d]='%s'-Rdaemon() failed: %.200s/dev/ttyFIPS mode initializedchdir("/"): %s/dev/nullinetd sockets after dupping: %d, %dToo many listen sockets. Enlarge MAX_LISTEN_SOCKSgetnameinfo failed: %.100ssocket: %.100ssetsockopt SO_REUSEADDR: %sBind to port %s on %s.Bind to port %s on %s failed: %.200s.listen on [%s]:%s: %.100sServer listening on %s port %s.Cannot bind any address.wCouldn't create pid file "%s": %s%ld [accepted]setsid: %.100srexec start in %d out %d newsock %d pipe %d sock %drexec of %s failed: %srexec cleanup in %d out %d newsock %d pipe %d sock %dsetsockopt SO_KEEPALIVE: %.100sget_remote_port failedConnection refused by tcp wrapperlibwrap refuse returnsConnection from %.500s port %dSSH-%d.%d-%.100s%s%s%sCould not write ident string to %sDid not receive identification string from %sSSH-1.5-W1.0SSH-%d.%d-%[^ ] Protocol mismatch. Bad protocol version identification '%.100s' from %sClient protocol version %d.%d; client software version %.100sprobed from %s with %s. Don't panic.scanned from %s with %s. Don't panic.Your ssh version is too old and is no longer supported. Please install a newer version.fork of unprivileged child failedNetwork child is on pid %ld%s: waitpid: %s%s: preauth child exited with status %d%s: preauth child terminated by signal %dsshd_net_tchroot("%s"): %sprivsep user:group %u:%usetgroups: %.100s[net]aes128-ctr,aes192-ctr,aes256-ctr,aes128-cbc,3des-cbc,aes192-cbc,aes256-cbc,rijndael-cbc@lysator.liu.sehmac-sha1,hmac-sha2-256,hmac-sha2-512none,zlib@openssh.com,list_hostkey_types: %s%s,%snullNo supported key exchange algorithmsKEX doneSent %d bit server key and %d bit host key.Warning: client selects unsupported cipher.IP Spoofing check bytes do not match.crcEncryption type: %.200sdo_ssh1_kex: BN_new failedPacket integrity error (%d bytes remaining) at %s:%dsshd.cPacket integrity error.do_ssh1_kex: bad session key len from %s: session_key_int %d > sizeof(session_key) %luReceived session key; encryption turned on.User child is on pid %ldTransferred: sent %llu, received %llu bytesClosing connection to %.500s port %dLocal version string %.200sProtocol major versions differ. Protocol major versions differ for %s: %.200s vs. %.200sdo_connection: generating a fake encryption key/etc/ssh/sshd_configecdh-sha2-nistp256,ecdh-sha2-nistp384,ecdh-sha2-nistp521,diffie-hellman-group-exchange-sha256,diffie-hellman-group-exchange-sha1,diffie-hellman-group14-sha1,diffie-hellman-group1-sha1ecdsa-sha2-nistp256-cert-v01@openssh.com,ecdsa-sha2-nistp384-cert-v01@openssh.com,ecdsa-sha2-nistp521-cert-v01@openssh.com,ssh-rsa-cert-v01@openssh.com,ssh-dss-cert-v01@openssh.com,ssh-rsa-cert-v00@openssh.com,ssh-dss-cert-v00@openssh.com,ecdsa-sha2-nistp256,ecdsa-sha2-nistp384,ecdsa-sha2-nistp521,ssh-rsa,ssh-dssaes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-gcm@openssh.com,aes256-gcm@openssh.com,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,rijndael-cbc@lysator.liu.sehmac-md5-etm@openssh.com,hmac-sha1-etm@openssh.com,umac-64-etm@openssh.com,umac-128-etm@openssh.com,hmac-sha2-256-etm@openssh.com,hmac-sha2-512-etm@openssh.com,hmac-ripemd160-etm@openssh.com,hmac-sha1-96-etm@openssh.com,hmac-md5-96-etm@openssh.com,hmac-md5,hmac-sha1,umac-64@openssh.com,umac-128@openssh.com,hmac-sha2-256,hmac-sha2-512,hmac-ripemd160,hmac-ripemd160@openssh.com,hmac-sha1-96,hmac-md5-96none,zlib@openssh.com,zlibUser %s hosts file %s is not a regular fileNO_PLUS%1023s %1023s %1023sFound empty line in %.100s.Found garbage in %.100s.Ignoring wild host/user names in %.100s.Matched negative entry in %.100s..shostsauth_rhosts2: clientuser %s hostname %s ipaddr %s%.500s/%.100s/etc/ssh/shosts.equiv/etc/hosts.equivAccepted for %.100s [%.100s] by /etc/hosts.equiv.Accepted for %.100s [%.100s] by %.100s.Rhosts authentication refused for %.100s: no home directory %.200sRhosts authentication refused for %.100s: bad ownership or modes for home directory.Rhosts authentication refused for %.100s: bad modes for %.200sBad file modes for %.200sServer has been configured to ignore %.100s.Accepted by %.100s.Accepted host %s ip %s client_user %s server_user %s.rhostsxxtrying public RSA key file %s%.100s, line %lu: non ssh1 key syntaxWarning: %s, line %lu: keysize mismatch: actual %d vs. announced %d.matching key found: file %s, line %lu %s %sauth_rsa_generate_challenge: BN_new() failedauth_rsa_generate_challenge: BN_rand failedauth_rsa_generate_challenge: BN_CTX_new failedauth_rsa_generate_challenge: BN_mod failedauth_rsa_verify_response: RSA modulus too small: %d < minimum %d bitsauth_rsa_verify_response: bad challenge length %dssh-rsa1unsuccessful auditauth_rsa_challenge_dialog: BN_new() failedauth-rsa.cWrong response to RSA authentication challenge.RSA authentication accepted.~/.ssh/known_hosts/etc/ssh/ssh_known_hostsTrying rhosts with RSA host authentication for client user %.100sRhosts RSA authentication: canonical host %.900sRhosts with RSA host authentication denied: unknown or invalid host keyYour host key cannot be verified: unknown or invalid host key.Client on %.800s failed to respond correctly to host authentication.Rhosts with RSA host authentication accepted for %.100s, %.100s on %.700s.Rhosts with RSA host authentication accepted.(unknown user)(invalid user)publickeykeyboard-interactivechallenge-responsehostbasedrhosts-rsagssapi-with-micLOGIN_EXCEED_MAXTRIESLOGIN_ROOT_DENIEDAUTH_SUCCESSAUTH_FAIL_NONEAUTH_FAIL_PASSWDAUTH_FAIL_KBDINTAUTH_FAIL_PUBKEYAUTH_FAIL_HOSTBASEDAUTH_FAIL_GSSAPIINVALID_USERNOLOGINCONNECTION_CLOSECONNECTION_ABANDONAUDIT_UNKNOWNaudit_event(unknown)linux_audit_write_entry failed: %ssshpubkey%s_auth rport=%dkey algo=%s size=%d fp=%s%s rport=%d%s: unhandled event %dop=unsupported-%s direction=? cipher=? ksize=? rport=%d laddr=%s lport=%d op=start direction=%s cipher=%s ksize=%d mac=%s spid=%jd suid=%jd rport=%d laddr=%s lport=%d cannot open auditcannot write into auditop=destroy kind=session fp=? direction=%s spid=%jd suid=%jd rport=%d laddr=%s lport=%d op=destroy kind=server fp=%s direction=? spid=%jd suid=%jd op=create kind=server fp=%s direction=? ciphermaccompmaxtries exceededroot deniedsuccessgssapinologinconnection closedconnection abandonedfrom-serverfrom-clientbothopenpty: %.100sopenpty returns device for which ttyname fails.chown %.100s 0 0 failed: %.100schmod %.100s 0666 failed: %.100sFailed to disconnect from controlling tty.Setting controlling tty using TIOCSCTTY.ioctl(TIOCSCTTY): %.100sopen /dev/tty failed - could not set controlling tty: %.100sstat(%.100s) failed: %.100schown(%.100s, %u, %u) failed: %.100schmod(%.100s, 0%o) failed: %.100sLast login: %s Last login: %s from %s derelativise_pathload_server_configparse_server_configUNKNOWNusepam%s %d unset2,1noyesdelayedwithout-passwordinetclientspecifiedbad addr or host: %s (%s)/etc/ssh/ssh_host_key/etc/ssh/ssh_host_rsa_key/etc/ssh/ssh_host_dsa_key/etc/ssh/ssh_host_ecdsa_key/var/run/sshd.pid/usr/bin/xauth.ssh/authorized_keys.ssh/authorized_keys2%s: getcwd: %s%s/%s(null)not %s: line %d: Bad configuration option: %s%s:%d setting %s %s%s line %d: Directive '%s' is not allowed within a Match block%s line %d: ports must be specified before ListenAddress.%s line %d: too many ports.%s line %d: missing port number.%s line %d: Badly formatted port number.%s line %d: missing integer value.%s line %d: missing time value.%s line %d: invalid time value.%s line %d: missing address%s line %d: bad address:port usage%s line %d: bad port number%s line %d: address family must be specified before ListenAddress.%s line %d: missing argument.%s line %d: unsupported option "%s".%s line %d: too many host keys specified (max %d).%s line %d: missing file name.%s line %d: missing socket name.%s line %d: too many host certificates specified (max %d).%s line %d: missing yes/no argument.%s line %d: Bad yes/no argument: %s%.200s line %d: Missing argument.default%.200s line %d: Bad number '%s': %s%.200s line %d: RekeyLimit too large%.200s line %d: RekeyLimit too small%.200s line %d: unsupported log facility '%s'%.200s line %d: unsupported log level '%s'%s line %d: too many allow users.%s line %d: too many deny users.%s line %d: too many allow groups.%s line %d: too many deny groups.%s line %d: Missing argument.%s line %d: Bad SSH2 cipher spec '%s'.%s line %d: Bad SSH2 mac spec '%s'.%s line %d: Bad SSH2 KexAlgorithms '%s'.%s line %d: Bad protocol spec '%s'.%s line %d: too many subsystems defined.%s line %d: Missing subsystem name.%s line %d: Subsystem '%s' already defined.%s line %d: Missing subsystem command.%s line %d: Missing MaxStartups spec.%d:%d:%d%s line %d: Illegal MaxStartups spec.%s line %d: too many authorized keys files.%s line %d: Invalid environment name.%s line %d: too many allow env.%s line %d: Missing yes/point-to-point/ethernet/no argument.Match directive not supported as a command-line optionchecking syntax for 'Match %s'checking match for '%s' user %s host %s addr %s laddr %s lport %dMissing Match criteria for %suser %.100s matched 'User %.100s' at line %dgroupCan't match group at line %d because user %.100s does not existCan't Match group because user %.100s not in any group at line %duser %.100s does not match group list %.100s at line %duser %.100s matched group list %.100s at line %dhostconnection from %.100s matched 'Host %.100s' at line %dconnection from %.100s matched 'Address %.100s' at line %dlocaladdressconnection from %.100s matched 'LocalAddress %.100s' at line %dlocalportInvalid LocalPort '%s' on Match lineconnection from %.100s matched 'LocalPort %d' at line %dUnsupported Match attribute %smatch %sfound%s line %d: Bad Match condition%s line %d: missing PermitOpen specification%s line %d: missing host in PermitOpen%s line %d: bad port number in PermitOpen %s line %d: Bad IPQoS value: %s%.200s line %d: Invalid argument%.200s line %d: AuthorizedKeysCommand must be an absolute path%s line %d: too many authentication methods.%s line %d: invalid authentication method list.%s line %d: Deprecated option %s%s line %d: Unsupported option %s%s line %d: Missing handler for opcode %s (%d)%s line %d: garbage at end of line; "%.200s".%s line %d: Bad yes/point-to-point/ethernet/no argument: %s%s: filename %s%s line %d too long%s: done config len = %daddr=host=user=laddr=lport=Invalid port '%s' in test mode specification %s Invalid test mode specification %s %s: config %s len %d%s: terminating, %d bad configuration optionsreprocess configport %d listenaddress [%s]:%s listenaddress %s:%s subsystem %s %s ipqos %s rekeylimit %lld %d maxstartups %d:%d:%d remotelocalsandboxnosandboxforced-commands-onlyinet6anypoint-to-pointethernetpamauthenticationviakbdintporthostdsakeyhostkeyagentpidfileserverkeybitslogingracetimekeyregenerationintervalpermitrootloginsyslogfacilityloglevelrhostsauthenticationrhostsrsaauthenticationhostbasedauthenticationhostbasedusesnamefrompacketonlyrsaauthenticationpubkeyauthenticationdsaauthenticationkerberosauthenticationkerberosorlocalpasswdkerberosticketcleanupkerberosgetafstokenkerberosusekuserokkerberostgtpassingafstokenpassinggssapiauthenticationgssapicleanupcredentialsgssapicleanupcredsgssapistrictacceptorcheckgssapikeyexchangegssapistorecredentialsonrekeygssusesessionccachegssapiusesessioncredcachepasswordauthenticationkbdinteractiveauthenticationchallengeresponseauthenticationskeyauthenticationzeroknowledgepasswordauthenticationcheckmaillistenaddressaddressfamilyprintmotdprintlastlogignorerhostsignoreuserknownhostsx11forwardingx11displayoffsetx11uselocalhostxauthlocationstrictmodespermitemptypasswordspermituserenvironmentuselogincompressionrekeylimittcpkeepalivekeepaliveallowtcpforwardingallowagentforwardingallowusersdenyusersallowgroupsdenygroupsciphersmacsprotocolgatewayportssubsystemmaxstartupsmaxauthtriesmaxsessionsbannershowpatchlevelusednsverifyreversemappingreversemappingcheckclientaliveintervalclientalivecountmaxauthorizedkeysfileauthorizedkeysfile2useprivilegeseparationacceptenvpermittunnelpermitopenforcecommandchrootdirectoryhostcertificaterevokedkeystrustedusercakeysauthorizedprincipalsfilekexalgorithmsipqosauthorizedkeyscommandauthorizedkeyscommanduserversionaddendumauthenticationmethodsserver_input_global_requestpipe(notify_pipe) failed %sfcntl(notify_pipe, F_SETFD) failed %sserver_init_dispatch_13server_init_dispatch_20server_init_dispatch_15Got %d/%u for keepaliveserver_input_global_request: rtype %s want_reply %dtcpip-forwardserver_input_global_request: no/invalid userserver_input_global_request: tcpip-forward listen %s port %dServer has disabled port forwarding.cancel-tcpip-forward%s: cancel-tcpip-forward addr %s port %dno-more-sessions@openssh.comEOF received for stdin.serverloop.cserver_input_channel_req: channel %d request %s reply %dserver_input_channel_req: unknown channel %deow@openssh.comserver_input_channel_open: ctype %s rchan %d win %d max %dinput_session_requestPossible attack: attempt to open a session after additional sessions disabledserver-sessionsession open failed, free channel %ddirect-tcpipserver_request_direct_tcpip: originator %s port %d, target %s port %drefused local port forward: originator %s port %d, target %s port %dtun@openssh.comUnsupported tunnel device mode.Server has rejected tunnel device forwardingtunserver_input_channel_open: confirm %sserver_input_channel_open: failure %sopen failedFailed to open the tunnel device.Window change received.Timeout, client not responding.keepalive@openssh.comnotify_done: readingConnection closed by %.100sRead error from remote host %.100s: %.100sReceived SIGCHLD.Entering interactive session.Waiting for forwarded connections to terminate... Exiting on signal %dEnd of interactive session; stdin %ld, stdout (read %ld, sent %ld), stderr %ld bytes.wait: %.100sStrange, wait returned pid %ld, expected %ldCommand exited with status %d.Received exit confirmation.Command terminated on signal %d.wait returned status %04x.Entering interactive session for SSH2.need rekeyingauth_key_is_revokedcheck_key_in_hostfiles/bin/shUser %.100s not allowed because shell %.100s does not existUser %.100s not allowed because shell %.100s is not executableUser %.100s from %.100s not allowed because listed in DenyUsersUser %.100s from %.100s not allowed because not listed in AllowUsersUser %.100s from %.100s not allowed because not in any groupUser %.100s from %.100s not allowed because a group is listed in DenyGroupsUser %.100s from %.100s not allowed because none of user's groups are listed in AllowGroupsUser %.100s not allowed because account is lockedPostponedPartialFailedAcceptedinvalid user ssh2ssh1: %s %s%s%s for %s%.100s from %.200s port %d %s%s%sRoot login accepted for forced command.ROOT LOGIN REFUSED FROM %.200sexpand_authorized_keys: path too longrealpath %s failed: %sbad ownership or modes for file %sdirname() failedbad ownership or modes for directory %sInvalid user %.100s from %.100s%s: treating %s as a key listRevoked keys file is unreadable: refusing public key authenticationWARNING: authentication attempt with a revoked %s key %s%s key_in_file returned junkAuthentication refused for %.100s: bad owner or modes for %.200sIgnored %.200s: bad ownership or modesWARNING: revoked key for %s attempted authentication%s: key for %s found at %s:%ld%s: key for host %s not foundCould not open %s '%s': %sUser %s %s %s is not a regular filecannot stat file %s: %sAuthentication refused: %sIgnored %s: %sauthorized keysauthorized principalsNOUSER$2a$06$r3.juUaHZDlIbQaO2dS9FuYxL1W9M81R1Tc92PoSNmzvpEqLkLGrK/nonexistauth1.csending challenge '%s'Warning: keysize mismatch for client_host_key: actual %d, announced %druser %.100sdo_authloop: BN_new failed [net]Access denied.do_authentication: invalid user %sCannot change user when server not running as root.Attempting authentication for %s%.100s.without authentication%s authentication disabled.INTERNAL ERROR: authenticated invalid user %sAccess denied for user %s by PAM account configurationToo many authentication failures for %.100sUnknown message during authentication: type %dbad-auth-msg-%duserauth_send_bannerauth2_setup_methods_listsauth2_update_methods_listsuserauth_finishauth2.cinput_service_request: no authctxtssh-userauthbad service request %s%s: sentempty authentication method listDisabled method "%s" in AuthenticationMethods list "%s"Unknown authentication method "%s" in list%s: checking methodsNo AuthenticationMethods left after eliminating disabled methodsAuthentication methods list "%s" contains disabled method, skippingauthentication methods list %d: %s%s: updating methods list after "%s"%s: method not in AuthenticationMethodsauthentication methods list %d completeauthentication methods list %d remaining: "%s"INTERNAL ERROR: authenticated and postponed%s: failure partial=%d next methods="%s"input_userauth_request: no authctxtuserauth-request for user %s service %s method %sattempt %d failures %dssh-connectioninput_userauth_request: setting up authctxt for %sinput_userauth_request: invalid user %sno authentication methods enabledChange of username or service not allowed: (%s,%s) -> (%s,%s)Unrecognized authentication method name: %sinput_userauth_request: try method %sCertificate options corruptfound certificate option "%.100s" len %upermit-X11-forwardingpermit-agent-forwardingpermit-port-forwardingpermit-ptypermit-user-rcforce-commandCertificate constraint "%s" corruptCertificate has multiple force-command optionssource-addressCertificate has multiple source-address optionsAuthentication tried for %.100s with valid certificate but not from a permitted host (ip=%.200s).Your address '%.200s' is not permitted to use this certificate for login.Certificate source-address contents invalidCertificate critical option "%s" is not supportedCertificate option "%s" corrupt (extra data)cert-authorityno-port-forwardingPort forwarding disabled.no-agent-forwardingAgent forwarding disabled.no-X11-forwardingX11 forwarding disabled.no-ptyPty allocation disabled.no-user-rcUser rc file execution disabled.command="principals="environment="from="%.100s, line %lu: invalid criteriaAuthentication tried for %.100s with correct key but not from a permitted host (host=%.200s, ip=%.200s).Your host '%.200s' is not permitted to use this key for login.permitopen="%.100s, line %lu: Bad permitopen specification <%.100s>%.100s, line %lu: Bad permitopen specification%.100s, line %lu: Bad permitopen port <%.100s>%.100s, line %lu: Bad permitopen porttunnel="%.100s, line %lu: invalid tun deviceForced tun device: %dBugs in auth-options.c option processing.Bad options in %.100s file, line %lu: %.50s%.100s, line %lu: missing end quoteForced command.principals: %.900sAdding to environment: %.900ssafely_chrootsession_unusedsession_newdo_exec_ptydo_exec_no_ptydump: used %d next_unused %d session %d %p channel %d pid %ldsession_close_x11: x11 channel %d missingsession_close_x11: detach x11 channel %dsession_close_single_x11: channel %dsession_by_x11_channel: session %d channel %dsession_by_x11_channel: unknown channel %dsession_close_single_x11: no x11 channel %dsession_close_single_x11: session %d: closing channel %dsession_by_channel: session %d channel %dsession_by_channel: unknown channel %d/tmp/ssh-XXXXXXXXXXAgent forwarding disabled: mkdtemp() failed: %.100s%s/agent.%ldbind: %.100slisten: %.100sauth socketcomponent chroot path does not begin at rootchroot path too long%s: checking '%s'%s: stat("%s"): %sbad ownership or modes for chroot directory %s"%s"chroot path %s"%s" is not a directoryUnable to chdir to chroot path "%s": %s%s: chdir(/) after chroot: %sChanged root directory to "%s"x11_create_display_inet failed.gethostname: %.100slocalhost:%u.%uunix:%u.%uCan't get IP address for X11 DISPLAY.%.50s:%u.%u/etc/motd%.200s/.hushlogingetpeername: %.100schild_set_env: too many env varsToo many lines in environment file %sBad line %u in %.100s Copy environment: %s=%ssetlogin failed: %ssetgidinitgroupsserver lacks privileges to chroot to ChrootDirectoryFailed to set uids to %u./usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin/usr/local/bin:/usr/binsftp-serverWARNING: Your password has expired. You must change your password now and login again! /usr/bin/passwdpasswdPassword change required but no TTY available. /etc/nologinUser %.100s not allowed because %s existsPAM session not opened, exitingLOGNAMEHOMEPATH%.200s/%.50s/var/mailMAILSHELLTZ%.50s %d %dSSH_CLIENT%.50s %d %.50s %dSSH_CONNECTIONSSH_TTYTERMDISPLAYSSH_ORIGINAL_COMMAND%.200s/.ssh/environmentEnvironment: %.200s Could not chdir to home directory %s: %s .ssh/rc%s -c '%s %s'Running %s Could not run %s Running %s %s /bin/sh /etc/ssh/sshrcRunning %.500s remove %.100s %.500s add %.100s %.100s %.100s %s -q -remove %s add %s %s %s This service allows sftp connections only.%s@%sinternal-sftp/usr/bin/login-h-p-f---c%s: session id %d unused%s: insane session id %d (max %d nalloc %d)%s: allocate (allocated %d max %d)%s: cannot allocate %d sessions%s: insane first_unused %d max %d nalloc %d%s: session %d already usedsession_new: session %dsession_open: channel %dno more sessionsno user for session %dsession_open: session %d: link with channel %dsession_by_id: unknown id %dsession_by_tty: session %d tty %ssession_by_tty: unknown tty %.100ssession_set_fds: called for proto != 2.0no channel for session %ddo_exec_pty: no session%s: dup #1: %s%s: dup #2: %s%s: fork: %.100sdup2 stdin: %sdup2 stdout: %sdup2 stderr: %ssession_pty_cleanup: no sessionsession_pty_cleanup: session %d release %sclose(s->ptymaster/%d): %sABRTALRMFPEHUPILLINTKILLPIPEQUITSEGVUSR1USR2SIG@openssh.comsession_by_pid: pid %ldsession_by_pid: unknown pid %ldsession_close_by_pid: no session for pid %ldsession_exit_message: session %d: no channel %dsession_exit_message: session %d channel %d pid %ldexit-statusexit-signalsession_exit_message: release channel %d/dev/Allocating a pty not permitted for this authentication.Protocol error: you already have a pty.Allocating pty.session_pty_req: session %d alloc failedsession_pty_req: session %d alloc %ssession.cdo_exec_no_pty: no session%s: pipe in: %.100s%s: pipe out: %.100s%s: pipe err: %.100ssetsid failed: %.100sdup2 stdindup2 stdoutdup2 stderrForced command (config) '%.900s'Forced command (key option) '%.900s'Allowed command '%.900s'do_exec: command already setcommand '%.900s' not allowedsession_close: session %d pid %ldsession_close_by_channel: no session for id %dsession_close_by_channel: channel %d child %ldsession_close_by_channel: channel %d: has childX11 forwarding disabled in user configuration file.X11 forwarding disabled in server configuration file.No xauth program; cannot forward with spoofing.X11 forwarding disabled; not compatible with UseLogin=yes.X11 display already set.session_input_channel_req: no session %d req %.100ssession_input_channel_req: session %d req %sshellexecpty-reqx11-reqsession_x11_req: session %d: x11 forwarding already activeauth-agent-req@openssh.comsession_auth_agent_req: no_agent_forwarding_flagauthentication forwarding requested twice.subsystem request for %.100s by user %ssubsystem: %ssubsystem: cannot stat %s: %ssubsystem: exec() %ssubsystem request for %.100s failed, subsystem not foundIgnoring env request %s: disallowed nameIgnoring env request %s: too many env varsSetting env %d: %s=%swindow-changebreakdo_cleanupReceived invalid compression level %d.compression disabledSSH_PROTOFLAG_SCREEN_NUMBER: %dBuggy client: X11 screen flag missingAuthentication agent forwarding not permitted for this authentication.Received authentication agent forwarding request.Port forwarding not permitted for this authentication.Port forwarding not permitted.Received TCP/IP port forwarding request.Port forwarding failed.Exec command '%.500s'command execution failedshell execution failedUnknown packet type received after authentication: %dpamget_challenge: numprompts < 1auth2_challenge_start: devices %skbdint_next_device: devices %sauth2_challenge_start: trying authentication method '%s'kbdint_alloc: devices '%s'auth2_challenge: user=%s devs=%sinput_userauth_info_response: no authctxtinput_userauth_info_response: no kbdintctxtinput_userauth_info_response: no deviceinput_userauth_info_response: wrong number of repliesinput_userauth_info_response: too many repliesauth2-chall.cgetgrouplist: groups list too small~/.ssh/known_hosts2userauth_hostbased: chost %s resolvedname %s ipaddr %sstripping trailing dot from chost %suserauth_hostbased mismatch: client sends %s, but we resolve %s to %suserauth_hostbased: access allowed by auth_rhosts2/etc/ssh/ssh_known_hosts2Accepted certificate ID "%s" signed by %s CA %s%s from %s@%sAccepted %s public key %s%s from %s@%suserauth_hostbased: disabled because of invalid useruserauth_hostbased: cuser %s chost %s pkalg %s slen %duserauth_hostbased: unsupported public key algorithm: %suserauth_hostbased: cannot decode key: %suserauth_hostbased: type mismatch for decoded key (received %d, expected %d)client user "%.100s", client host "%.100s"userauth_hostbased: authenticated %dauth2-kbdint.ckeyboard-interactive devs %sauth2-none.cauth2-passwd.cpassword change not supporteduser_key_command_allowed2pubkey_auth_infouser_cert_trusted_catrying authorized principals file %smatched principal "%.100s" from file "%s" on line %luuser_key_allowed: check options: '%s'user_key_allowed: advance: '%s'matching CA found: file %s, line %lu, %s %s%smatched principal from key options "%.100s"Accepted certificate ID "%s" signed by %s CA %s via %sFound matching %s key: %s%skey not foundCertificate does not contain an authorized principalNo user for AuthorizedKeysCommand specified, skippingAuthorizedKeysCommandUser "%s" not found: %sCould not stat AuthorizedKeysCommand "%s": %sUnsafe AuthorizedKeysCommand: %s%s: pipe: %sRunning AuthorizedKeysCommand: "%s %s" as "%s"%s: fork: %s%s: open %s: %s%s: dup2: %ssetresgid %u: %ssetresuid %u: %sfailed to copy environment: %sAuthorizedKeysCommand %s exec failed: %s%s: fdopen: %sAuthorizedKeysCommand %s exited on signal %dAuthorizedKeysCommand %s returned status %d, %s: vasprintf failed%s ID %s (serial %llu) CA %s %s%s%s%s %s%s%s%s: CA %s%s %s is not listed in %strying public key file %suserauth_pubkey: disabled because of invalid useruserauth_pubkey: SSH_BUG_PKAUTHuserauth_pubkey: unsupported public key algorithm: %suserauth_pubkey: cannot decode key: %suserauth_pubkey: type mismatch for decoded key (received %d, expected %d)auth2-pubkey.c%s%s%s%s%stest whether pkalg/pkblob are acceptableuserauth_pubkey: authenticated %d pkalg %smm_xmallocmm_share_syncmm_free(%p): double address %pmm_free: memory corruption: %p(%lu) > %pmm_free: memory corruption: %p < %p(%lu)mm_free(%p): can not find %pmunmap(%p, %lu): %smm_malloc: try to allocate 0 spacemm_malloc: size too big%s: mm_malloc(%lu)mm_make_entry(%p): double address %p->%p(%lu)mmap(%lu): %smm_memvalid: address too small: %pmm_memvalid: end < address: %p < %pmm_memvalid: address too large: %p%s: Share sync%s: Share sync endmm_answer_modulimm_answer_pam_free_ctxmm_answer_signmm_answer_authpasswordmm_answer_pam_init_ctxmm_answer_pam_querymm_answer_pam_respondmm_answer_keyallowedmm_answer_keyverifymm_session_closemm_answer_pty_cleanupmm_answer_sesskeymm_answer_rsa_keyallowedmm_answer_rsa_challengemm_answer_rsa_responsemm_answer_termmm_answer_audit_eventmonitor_openfdsmm_answer_gss_userokmm_answer_gss_signmonitor_read_logmm_answer_sessidmm_answer_pam_startmm_answer_pam_accountmm_answer_ptymm_answer_audit_commandmm_answer_audit_end_commandmm_zallocmm_answer_pwnamallowmm_answer_authrolemm_answer_authservmonitor_readmm_get_keystatemonitor_child_preauth%s: got parameters: %d %d %d%s: bad parameters: %d %d %d%s: data length incorrect: %u%s: no hostkey from index %d%s: signature %p(%u)%s: sending result %dnot allowed%s entering%s: key type and protocol mismatch%s: key_from_blob: %p%s: unknown key type %d%s: key %p is %sverifiedunverified%s: bad key, not previously allowed%s: bad key type%s: bad public key blobwrong user name passed to monitor: expected %s != %.100s%s: bad signature data blob%s: key %p signature %s%s: session %d pid %ld%s: tty %s ptyfd %d%s: command %d%s: BN_new%s: key_to_blob failed%s: authctxt not valid%s: key type mismatch%s: received bad key%s: received bad key type %d%s sending reply%s: no ssh1_challenge%s: key type mismatch: %d%s: received bad response to challenge%s: tearing down sessionsAudit event type %d not permitted%s: socketpair: %sfcntl(%d, F_SETFD)In GSSAPI monitor when GSSAPI is disabled%s: data length incorrect: %d%s: child log fd closed%s: log fd read: %s%s: invalid log message length %u%s: invalid log level %u (corrupted message?)%s [preauth]%s: bad ssh1 session idUsePAM not set, but ended up in %s anyway%s: dup2%s: send fds failed%s: open(/dev/null): %s%s: fd0 %d != 0%s: error allocating a session%s: invalid handle%s: mm_zalloc(%u, %u)%s: multiple attempts for getpwnam%s: no valid authentication method lists%s: sending MONITOR_ANS_PWNAM: %d%s [priv]%s: role=%s%s: service=%s, style=%s%s: poll: %s%s: checking request %d%s: unpermitted request %d%s: %d used once, disabling now%s: unsupported request: %d%s: Waiting for new keysmm_get_get: internal error: bad session id%s: Waiting for second key%s: Getting compression state%s: bad request size%s: Getting Network I/O bufferspreauth child monitor startedAuthenticationMethods is not supportedwith SSH protocol 1%s: method %s: partial%s: unexpected authentication from %d%s: authenticated invalid user%s: authentication method name unknown%s: %s has been authenticated by privileged processmm_log_handlermm_request_sendmm_request_receivemm_request_receive_expectmm_choose_dhmm_key_signmm_getpwnamallowmm_auth2_read_bannermm_inform_authservmm_inform_authrolemm_auth_passwordmm_key_allowedmm_key_verifymm_newkeys_from_blobmm_newkeys_to_blobmm_send_keystatemm_pty_allocatemm_start_pammm_do_pam_accountmm_sshpam_init_ctxmm_sshpam_querymm_sshpam_respondmm_sshpam_free_ctxmm_bsdauth_querymm_bsdauth_respondmm_ssh1_session_idmm_auth_rsa_key_allowedmm_auth_rsa_generate_challengemm_auth_rsa_verify_responsemm_audit_eventmm_audit_run_commandmm_audit_end_commandmm_ssh_gssapi_userok%s: no log channel%s: write: %s%s entering: type %d%s: read: %s%s: read: bad msg_len %d%s: read: rtype %d != type %d%s: waiting for MONITOR_ANS_MODULI%s: MONITOR_ANS_MODULI failed%s: BN_new failed%s: remaining %d%s: waiting for MONITOR_ANS_SIGN%s: waiting for MONITOR_ANS_PWNAM%s: struct passwd size mismatch%s: option block size mismatch%s: waiting for MONITOR_ANS_AUTHPASSWORD%s: user %sauthenticated%s: waiting for MONITOR_ANS_KEYALLOWEDtrue%s: waiting for MONITOR_ANS_KEYVERIFY%s: %p(%d)%s: bad cipher name %s or pointer %p%s: can not setup mac %s%s: bad mac key length: %u > %dnewkeys_from_blob: remaining bytes in blob %u%s: converting %p%s: newkey == NULL%s: Sending ssh1 KEY+IV%s: Sending new keys: %p %p%s: conversion of newkeys failed%s: New keys have been sent%s: Sending compression state%s: Finished sending state%s: cannot allocate fds for pty%s: waiting for MONITOR_ANS_PTY%s: pty alloc failed%s: receive fds failedUsePAM=no, but ended up in %s anyway%s returning %d%s: waiting for MONITOR_ANS_PAM_INIT_CTX%s: pam_init_ctx failed%s: waiting for MONITOR_ANS_PAM_QUERY%s: pam_query returned %d%s: recieved %u PAM messages, expected <= %u%s: waiting for MONITOR_ANS_PAM_RESPOND%s: pam_respond returned %d%s: waiting for MONITOR_ANS_PAM_FREE_CTX%s: entering%s: no challenge%s: received challenge: %s%s: key_from_blob failed%s entering command %skexdh_server%s: Unexpected KEX type %dexpecting SSH2_MSG_KEXDH_INITCannot load hostkeyUnsupported hostkey type %ddh_client_pub == NULLkexdhs.cbad client public DH valueDH_compute_key: failedkexdh_server: BN_new failedkexdh_server: BN_bin2bn failedSSH2_MSG_KEX_DH_GEX_REQUEST receivedSSH2_MSG_KEX_DH_GEX_REQUEST_OLD receivedprotocol error during kex, no DH_GEX_REQUEST: %dkexgexs.cDH_GEX_REQUEST, bad parameters: %d !< %d !< %dProtocol error: no matching DH grp foundSSH2_MSG_KEX_DH_GEX_GROUP sentexpecting SSH2_MSG_KEX_DH_GEX_INITkexgex_server: BN_new failedkexgex_server: BN_bin2bn failedSSH2_MSG_KEX_DH_GEX_REPLY sentkexecdh_server%s: EC_KEY_new_by_curve_name failed%s: EC_KEY_generate_key failedexpecting SSH2_MSG_KEX_ECDH_INIT%s: EC_POINT_new failedkexecdhs.c%s: invalid client public key%s: ECDH_compute_key failed%s: BN_bin2bn failedssh_krb5_expand_templatessh_krb5_cc_genkrb5_cleanup_proc called/primarycache dir '%s' remove failed: %scache primary file '%s', remove failed: %s{uid}{euid}{USERID}{TEMP}/tmp%s: unsupported token %s in %s%{libdefaultsdefault_ccache_namemkstemp(): %.100sfchmod(): %.100s%s: Setting ccname to %sFILE:/tmp/krb5cc_%d_XXXXXXXXXX%s:%sKerberos password authentication failed: %sKerberos password authentication failed: %dauth2-gss.cgssapi-keyexMechanism negotiation is not supportedBadly formed OID receivedNo authentication or GSSAPI contextGSSAPI MIC check failedssh_gssapi_cleanup_credsRekeyed credentials have different mechanismRekeyed credentials have different nameMarking rekeyed credentials for exportReceived some client credentialsGot no client credentialsCouldn't convert client name%s: krb5_cc_resolve(): %.100sssh_gssapi_storecreds: Not a GSSAPI mechanismSetting %s to %sNo suitable client datassh_gssapi_userok: Unknown GSSAPI mechanismNo update function for this mechanismRekeyed credentials stored successfullyNot even going to try and do PAM with privsep disabledsshd-rekeykrb5_cc_get_principal(): %.100skrb5_unparse_name(): %.100sName in local credentials cache differs. Not storingkrb5_cc_initialize(): %.100sgss_krb5_copy_ccache() failed. Sorry!%s/.k5login%s/.k5usersUser %s fopen %s failed: %sUser %s fstat %s failed: %sUser %s %s is not owned by root or userUser %s %s is not a regular file No credentials storedCannot initialize krb5 contextssh_krb5_cc_gen(): %.100skrb5_parse_name(): %.100sgss_krb5_copy_ccache() failedFILEAuthorized to %s, krb5 principal %s (krb5_kuserok)Authorized to %s, krb5 principal %s (ssh_gssapi_krb5_cmdok)toWM5Slw5Ew8Mqkay+al2g==Kerberos*Hkexgss_server%s: Identifying %sUnknown gssapi mechanism%s: Acquiring credentialsUnable to acquire credentials for the serverDoing group exchangekexgsss.cGSS_GEX, bad parameters: %d !< %d !< %dProtocol error: no matching group foundWait SSH2_MSG_GSSAPI_INITReceived KEXGSS_INIT after initialisingProtocol error: didn't expect packet type %dZero length token output when incompleteNo client public keySending GSSAPI_CONTINUEaccept_ctx diedMutual Authentication flag wasn't setIntegrity flag wasn't setkexgss_server: BN_new failedkexgss_server: BN_bin2bn failedCouldn't get MIClastlog_openseeklogin_init_entrysyslogin_perform_logoutsyslogin_write_entrylastlog_write_entrylastlog_get_entrylogin_get_lastlogrecord_failed_login/var/log/lastlog%s: Couldn't stat %s: %s%s: %.100s is not a file or directory!%s: Couldn't open %s: %s%s: %s->lseek(): %s%s: Cannot find user "%s"%s: logout() returned an error%s: Invalid type field%s: Error writing to %s: %sAttempt to write login records by non-root user (aborting)%s: Error reading from %s: %s%s: Error reading from %s: Expecting %d, got %d%s: Cannot find account for uid %ld/var/log/btmpUnable to open the btmp file %s: %s%s: fstat of %s failed: %sExcess permission or bad ownership on file %sssh:nottyFailed to write to %s: %ssshpam_null_convsshpam_store_convsshpam_thread_convsshpam_passwd_convsshpam_tty_convsshpam_respondsshpam_password_change_requiredsshpam_queryimport_environmentssshpam_thread_cleanuppthread_joinsshpam_free_ctxdo_pam_accountsshpam_threadsshpam_init_ctxsshpam_auth_passwdPAM: %s entering, %d messagesPAM: %s called with %d messagesPAM: conversation function passed a null contextPAM: initializing for "%s"PAM: setting PAM_RHOST to "%s"PAM: setting PAM_TTY to "ssh"PAM: authentication thread exited unexpectedlyPAM: authentication thread exited uncleanlyPAM: %s entering, %u responsesPAM: expected one response, got %u%s %d%s: PAM authctxt not initializedillegal user PAM: %s enteringPAM: %sInternal error: PAM auth succeeded when it should have failed%s: received %u environment variables, expected <= 1024PAM: num env strings %dPAM: num PAM env strings %dPAM: pam_putenv: %sPAM: %s for %s%.100s from %.100sPAM: cleanupPAM: closing sessionPAM: deleting credentialsPAM: initialisation requested when UsePAM=noPAM: initialisation failed%s: calledPAM: %s pam_acct_mgmt = %d (%s)PAM: could not set TZ environment: %s%s [pam]OKPAM: initialization failedPAM: failed create sockets: %sfork(): %sPAM: failed to start authentication thread: %sPAM: setting PAM_TTY to "%s"PAM: failed to set PAM_TTY: %sPAM: failed to set PAM_CONV: %sPAM: establishing credentialsPAM: reinitializing credentialsPAM: pam_setcred(): %sPassword expired (unable to change with privsep)PAM: changing passwordPAM: pam_chauthtok(): %sPAM: opening sessionPAM: pam_open_session(): %san illegal userPAM: %s called when PAM disabled or failed to initialise.PAM: %s: failed to set PAM_CONV: %sPAM: password authentication accepted for %.100sPAM: password authentication failed for %.100s: %sauth_shadow_acctexpiredauth_shadow_pwexpired%s: today %d sp_expire %d days left %daccount expiration disabledAccount %.100s has expiredaccount will expire in %d daysYour account will expire in %d day%s. Could not get shadow information for %.100s%s: today %d sp_lstchg %d sp_max %dUser %.100s password has expired (root forced)password expiration disabledUser %.100s password has expired (password aged)password will expire in %d daysYour password will expire in %d day%s. request %u: sent status %usent status %srequest %u: sent handle handle %drequest %u: sent attrib have 0x%xrequest %u: %sstat%sstat name "%s"request %u: sent names count %d%s%sclosedir "%s"%s%sclose "%s" bytes read %llu written %llusession closed for local user %s from [%s]forcedInvalid log level "%s"Invalid log facility "%s"Invalid umask "%s"usage: %s [-ehR] [-d start_directory] [-f log_facility] [-l log_level] [-u umask] d:f:l:u:cehRMalformed SSH_CONNECTION variable: "%s"session opened for local user %s from [%s]chdir to "%s" failed: %sselect: %sread eofbad message from %s local user %sreceived client version %uposix-rename@openssh.comstatvfs@openssh.comfstatvfs@openssh.comhardlink@openssh.comrequest %u: open flags %dREADWRITECREATETRUNCATEEXCLopen "%s" flags %s mode 0%orequest %u: close handle %urequest %u: read "%s" (handle %d) off %llu len %dread change len %dprocess_read: seek failedrequest %u: sent data len %drequest %u: write "%s" (handle %d) off %llu len %dprocess_write: seek failedprocess_write: write failednothing at all writtenrequest %u: fstat "%s" (handle %u)request %u: setstat name "%s"set "%s" size %lluset "%s" mode %04o%Y%m%d-%H:%M:%Sset "%s" modtime %sset "%s" owner %lu group %lurequest %u: fsetstat handle %drequest %u: opendiropendir "%s"request %u: readdir "%s" (handle %d)request %u: removeremove name "%s"request %u: mkdirmkdir name "%s" mode 0%orequest %u: rmdirrmdir name "%s"request %u: realpathrealpath "%s"request %u: renamerename old "%s" new "%s"request %u: readlinkreadlink "%s"request %u: symlinksymlink old "%s" new "%s"request %u: posix-renameposix-rename old "%s" new "%s"request %u: statfsstatfs "%s"request %u: fstatvfs "%s" (handle %u)request %u: hardlinkhardlink old "%s" new "%s"Unknown message %diqueue grew unexpectedlymsg_len %d < consumed %dSuccessEnd of fileNo such filePermission deniedFailureBad messageNo connectionConnection lostOperation unsupportedUnknown errorGot file attribute "%s"No errorNo such file or directoryUnknown status%b %e %H:%M%b %e %Y%s %3u %-*s %-*s %8s %s %s%s %3u %-*s %-*s %8llu %s %sset_out_buffer_size%s: bad buffer size %luroaming_read failed for %d ret=%ld errno=%dresend_bytes: resend %lu bytes from %lluNeeded to resend more data than in the cachessh_sandbox_initssh_sandbox_childssh_sandbox_parent_finish%s: preparing rlimit sandbox%s: setrlimit(RLIMIT_FSIZE, { 0, 0 }): %s%s: setrlimit(RLIMIT_NOFILE, { 0, 0 }): %s%s: setrlimit(RLIMIT_NPROC, { 0, 0 }): %s%s: finishedssh_encode_identity_ssh2Error writing to authentication socket.Error reading response length from authentication socket.Authentication response too long: %uError reading response from authentication socket.Bad authentication reply message type: %dToo many identities in authentication reply: %dWarning: identity keysize mismatch: actual %d, announced %uCompatibility with ssh protocol version 1.0 no longer supported.Agent admitted failure to authenticate using the key.Bad authentication response: %dAgent admitted failure to sign using the key.SSH_AGENT_FAILUREBad response from authentication agent: %d%s: no cert/certblobSSH PRIVATE KEY FILE FORMAT 1.1 key_parse_private_pemkey_parse_private_rsa1key_private_pem_to_blobkey_private_to_blobkey_load_filekey_parse_private_typekey_load_private_certkey_in_fileTruncated RSA1 identifierIncorrect RSA1 identifierdsa w/o commentrsa w/o commentecdsa w/o comment%s: BIO_new_mem_buf failed%s: PEM_read_PrivateKey failed%s: RSA_blinding_on failed%s: bad ECDSA key%s: PEM_read_PrivateKey: mismatch or unknown EVP_PKEY save_type %dread PEM private key done: type %s-----BEGINUnsupported RSA1 cipher %dcipher_set_key_string failed.Bad passphrase supplied for RSA1 keysave_private_key_rsa: bad cipherpassphrase too short: have %d bytes, need > 4%s: BIO_new failed%s: cannot save key type %dopen %s failed: %s.write to key file %s failed: %s%s: fstat of key file %.200s%sfailed: %.100s%s: key file %.200s%stoo large%s: read from key file %.200s%sfailed: %.100s%s: key file %.200s%schanged size while readingCould not load "%s" as a RSA1 public keyssh_keys@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ WARNING: UNPROTECTED PRIVATE KEY FILE! @Permissions 0%3.3o for '%s' are too open.It is required that your private key files are NOT accessible by others.This private key will be ignored.could not open key file '%s': %sbad permissions: ignore key: %s%s: cannot parse key type %d.pub%s-cert.pub%s: unsupported key type%s: certificate does not match private key %s%s: key_to_certified failed%s: keyfile "%s" missing%s: could not open keyfile "%s": %sbuffer_get_short: buffer errorbuffer_get_int: buffer errorbuffer_get_string_ret: cannot extract lengthbuffer_get_string_ret: bad string length %ubuffer_get_string_ret: buffer_get failedbuffer_get_string: buffer errorbuffer_get_cstring_ret: string contains \0buffer_get_cstring: buffer errorbuffer_get_string_ptr: bad string length %ubuffer_get_string_ptr: buffer errorbuffer_put_cstring: s == NULLbuffer_get_char_ret: buffer_get_ret failedbuffer_get_char: buffer errorbuffer_put_bignum_ret: BN_bn2bin() failed: oi %d != bin_size %dbuffer_put_bignum: buffer errorbuffer_get_bignum_ret: invalid lengthbuffer_get_bignum_ret: input buffer too smallbuffer_get_bignum_ret: BN_bin2bn failedbuffer_get_bignum_ret: buffer_consume failedbuffer_get_bignum: buffer errorbuffer_put_bignum2_ret: negative numbers not supportedbuffer_put_bignum2_ret: BN too smallbuffer_put_bignum2_ret: BN_bn2bin() failed: oi %d != bin_size %dbuffer_put_bignum2: buffer errorbuffer_get_bignum2_ret: invalid bignumbuffer_get_bignum2_ret: negative numbers not supportedbuffer_get_bignum2_ret: cannot handle BN of size %dbuffer_get_bignum2_ret: BN_bin2bn failedbuffer_get_bignum2: buffer errorbuffer_append_space: len %u not supportedbuffer_append_space: alloc %u not supportedbuffer_get_ret: trying to get more bytes %d than in buffer %dbuffer_get: buffer errorbuffer_consume_ret: trying to get more bytes than in bufferbuffer_consume: buffer errorbuffer_consume_end: trying to get more bytes than in buffer%02xNormalising mapped IPv4 in IPv6 addressgetpeername failed: %.100sipConnection from %.100s with IP options:%.800s %2.2xget_remote_hostname: getnameinfo NI_NUMERICHOST failedTrying to reverse map address %.100s.Nasty PTR record "%s" is set up for %s, ignoringreverse mapping checking getaddrinfo for %.700s [%s] failed - POSSIBLE BREAK-IN ATTEMPT!Address %.100s maps to %.600s, but this does not map back to the address - POSSIBLE BREAK-IN ATTEMPT!get_socket_address: getnameinfo %d failed: %sget_local_name: gethostname: %sgetsockname failed: %.100sget_sock_port: getnameinfo NI_NUMERICSERV failed: %schannel_post_mux_clientconnect_nextchannel_post_mux_listenerchannel_handlerchannel_cancel_rport_listenerchannel_cancel_lport_listenerchannel_request_rforward_cancelchannel %d: rfd %d isatty0.0.0.0localhost127.0.0.1%s: listening port %d for %.100s port %d, connect from %.200s port %dchannel %d: waiting for connectionchannel %d: ctl read<=0 rfd %d len %d%s: entered with !compat20channel %d: packet too big %u > %uchannel %d: mux_rcb failedchannel %d: obuf_empty delayed efd %d/(%d)channel %d: closing after input drain.connect_next: getnameinfo failed%s: set_nonblock(%d)connect_next: host %.100s ([%.100s]:%s): %.100sconnect_next: host %.100s ([%.100s]:%s) in progress, fd=%dgetsockopt SO_ERROR failedchannel %d: connected to %s port %dchannel %d: connection failed: %sconnect_to %.100s port %d: failed.channel %d: read<=0 rfd %d len %dchannel %d: not openchannel %d: input draining.channel %d: filter stopsSOCKS4SOCKS4Achannel %d: decode socks4channel %d: socks4a requestchannel %d: decode socks4: too longchannel %d: decode socks4: user %s/%dchannel %d: decode socks4: len %d > have %dchannel %d: decode socks4a: host %s/%dchannel %d: decode socks4a: len %d > have %dchannel %d: hostname "%.100s" too longchannel %d: dynamic request: socks4 host %s port %u command %uchannel %d: cannot handle: %s cn %dchannel %d: decode socks5channel %d: socks5 auth donechannel %d: socks5 post authchannel %d: only socks5 connect supportedchannel %d: bad socks5 atyp %dchannel %d: dynamic request: socks5 host %s port %u command %uchannel %d: method SSH_SOCKS5_NOAUTH not foundchannel %d: pre_dynamic: have %dchannel %d: pre_dynamic: need moreInitial X11 packet contains bad byte order byte: 0x%xX11 connection uses different authentication protocol.X11 auth data does not match fake data.X11 fake_data_len %d != saved_data_len %dX11 connection rejected because of wrong authentication.X11 rejected %d i%d/o%dX11 closed %d i%d/o%dsetsockopt SO_REUSEADDR fd %d: %schannel_by_id: %d: bad idchannel_by_id: %d: bad id: channel freeNon-public channel %d, type %d.channel_new: internal error: channels_alloc %d too big.channel: expanding %dchannel %d: new [%s]multiplexing control connection%s accept: %s%s getpeereid failed: %smultiplex uid mismatch: peer euid %u != uid %umultiplex clientmux-control%s: new mux channel %d fd %daccept from auth socket: %.100saccepted auth socketauth-agent@openssh.comforwarded-tcpipdynamic-tcpipConnection to port %d forwarding to %.100s port %d requested.No forward host name.Forward host name too long.getaddrinfo: fatal error: %schannel_setup_fwd_listener: getaddrinfo(%.64s): %schannel_setup_fwd_listener: getnameinfo failedLocal forwarding listening on %s port %s.Allocated listen port %dport listenerchannel_setup_fwd_listener: cannot listen to port: %dchannel_setup_fwd_listener: type %d wildcard %d addr %sconnect_to %.100s: unknown host (%s)connect to %.100s port %d failed: %sX11 connection requested.single_connection: closing X11 listener.X11 connection from %.200s port %daccepted x11 socketx11ssh2 x11 bug compat modechannel %d: written %d to efd %dchannel %d: closing write-efd %dchannel %d: read %d from efd %dchannel %d: closing read-efd %dchannel %d: discard efdchannel %d: forcing writechannel %d: window %d sent adjust %dchannel %d: big output buffer %u > %ucannot happen: SSH_CHANNEL_LARVALcannot happen: OUT_DRAINchannel_still_open: bad channel type %dchannel_find_open: bad channel type %dThe following connections are open: #%d %.300s (t%d r%d i%d/%d o%d/%d fd %d/%d cc %d) channel_open_message: bad channel type %d???channel %d: free: %s, nchannels %uchannel %d: status: %s%s: chan %d: skip for %d more secondschannel %d: gc: notify userchannel %d: gc: user detachedchannel %d: garbage collecting%s: first channel unpauses in %d secondschannel_send_open: %d: bad idchannel %d: send openchannel_request_start: %d: unknown channel idchannel %d: request %s confirm %dchannel_register_expect: %d: bad idchannel_register_open_confirm: %d: bad idchannel_register_cleanup: %d: bad idchannel_cancel_cleanup: %d: bad idchannel_register_filter: %d: bad idchannel_activate for non-larval channel %d.channel_connect_stdio_fwd %s:%dstdio-forwardchannel %d: will not send data after closechannel %d: datagram too big for channelcannot happen: istate == INPUT_WAIT_DRAIN for proto 1.3channel %d: ibuf_empty delayed efd %d/(%d)channel %d: rwin %u elen %u euse %dchannel %d: sent ext data %dReceived data for nonexistent channel %d.channel %d: rcvd big packet %d, maxpack %dchannel %d: rcvd too much data %d, win %dchannels.cReceived extended_data for bad channel %d.channel %d: ext data for non openchannel %d: accepting ext data after eofReceived extended_data after EOF on channel %d.channel %d: bad ext datachannel %d: rcvd too much extended_data %d, win %dchannel %d: rcvd ext data %dReceived ieof for nonexistent channel %d.channel %d: FORCE input drainReceived close for nonexistent channel %d.Received oclose for nonexistent channel %d.Received close confirmation for out-of-range channel %d.Received close confirmation for non-closed channel %d (type %d).Received open confirmation for non-opening channel %d.callback startcallback donechannel %d: open confirm rwindow %u rmax %uadministratively prohibitedconnect failedunknown channel typeresource shortageunknown reasonReceived open failure for non-opening channel %d.channel %d: open failed: %s%s%sReceived window adjust for non-open channel %d.channel %d: rcvd adjust %uchannel_input_status_confirm: type %d id %dchannel_input_status_confirm: %d: unknown%s: close channel %dProtocol error for port forward request:received packet type %d.%s: requested forward not foundRequested forwarding of port %d but user is not root.Dynamic forwarding denied.allow port forwarding to host %s port %dchannel_update_permitted_opens: index out of range: %d num_permitted_opens %d%s allowed port %d for forwarding to host %s port %dRemovingUpdatingconfig allows port forwarding to host %s port %d any none %s:%dWARNING: Server requests forwarding for unknown listen_port %dReceived request to connect to host %.100s port %d, but the request was denied.unknown (remote did not supply name)connected socketgetaddrinfo: %.100sx11_create_display_inet: Socket family %d not supportedbind port %d: %.100sx11 listenerX11 inet listenerFailed to allocate internet-domain X11 display socket.DISPLAY not set.unix:Could not parse display number from DISPLAY: %.100s/tmp/.X11-unix/X%uconnect %.100s: %.100sCould not find ':' in DISPLAY: %.100s%.100s: unknown host. (%s)connect %.100s port %u: %.100sReceived X11 open request.connected x11 socketWarning: ssh server tried agent forwarding.Warning: ssh server tried X11 forwarding.deny_input_open: type %dWarning: this is probably a break-in attempt by a malicious server.x11_request_forwarding_with_spoofing: different $DISPLAY already forwarded%2xx11_request_forwarding: bad authentication data: %.100scipher_cryptcipher_get_keyivcipher_set_keyivbad cipher %s [%s]cipher ok: %s [%s]ciphers ok: [%s]Warning: use of DES is strongly discouraged due to cryptographic weaknessescipher_init: key length %d is insufficient for %s.cipher_init: iv length %d is insufficient for %s.cipher_init: EVP_CipherInit failed for %scipher_init: EVP_CTRL_GCM_SET_IV_FIXED failed for %scipher_init: set keylen (%d -> %d)cipher_init: set keylen failed (%d -> %d)cipher_init: EVP_CipherInit: set key failed for %sevp_crypt: EVP_Cipher failed during discard%s: authlen mismatch %d%s: EVP_CTRL_GCM_IV_GEN%s: EVP_CTRL_GCM_SET_TAG%s: EVP_Cipher(aad) failed%s: bad plaintext length %d%s: EVP_Cipher failed%s: EVP_Cipher(final) failedDecryption integrity check failed%s: EVP_CTRL_GCM_GET_TAGcipher_cleanup: EVP_CIPHER_CTX_cleanup failed%s: wrong iv length %d != %d%s: bad cipher %d3des3des-cbcaes128-cbcaes192-cbcaes256-cbcaes128-ctraes192-ctraes256-ctraes128-gcm@openssh.comaes256-gcm@openssh.comblowfishblowfish-cbccast128-cbcarcfourarcfour128arcfour256ssh1_3des_ivssh1_3des_cbc: no context%s: bad 3des iv length: %d%s: no 3des context%s: Installed 3DES IV%s: Copying 3DES IVEnabling compatibility mode for protocol 2.0Enabling compatibility mode for protocol 1.3OpenSSH-2.0*,OpenSSH-2.1*,OpenSSH_2.1*,OpenSSH_2.2*match: %s pat %sno match: %signoring bad proto spec: '%s'.No available ciphers found.aesOriginal cipher proposal: %sCompat cipher proposal: %sOpenSSH_2.3.0*OpenSSH_2.3.*OpenSSH_2.5.0p1*,OpenSSH_2.5.1p1*OpenSSH_2.5.0*,OpenSSH_2.5.1*,OpenSSH_2.5.2*OpenSSH_2.5.3*OpenSSH_2.*,OpenSSH_3.0*,OpenSSH_3.1*OpenSSH_3.*Sun_SSH_1.0*OpenSSH_4*OpenSSH_5*OpenSSH**MindTerm*2.1.0*2.1 *2.0.13*,2.0.14*,2.0.15*,2.0.16*,2.0.17*,2.0.18*,2.0.19*2.0.11*,2.0.12*2.0.*2.2.0*,2.3.0*2.42.*3.0.*3.0 SecureCRT*1.7 SecureFX*1.2.18*,1.2.19*,1.2.20*,1.2.21*,1.2.22*1.3.2**SSH Compatible Server**OSU_0*,OSU_1.0*,OSU_1.1*,OSU_1.2*,OSU_1.3*,OSU_1.4*,OSU_1.5alpha1*,OSU_1.5alpha2*,OSU_1.5alpha3**SSH_Version_Mapper*Probe-*Enabling compression at level %d.Bad compression level %d.1.2.8compress outgoing: raw data %llu, compressed %llu, factor %.2fcompress incoming: raw data %llu, compressed %llu, factor %.2fbuffer_compress: deflate returned %dbuffer_uncompress: inflate returned %dload_hostkeysextract_salt: string too short|1|extract_salt: invalid magic identifierextract_salt: missing salt termination characterextract_salt: bad encoded salt length %uextract_salt: salt decode errorextract_salt: expected salt len %d, got %dhost_hash: __b64_ntop failed%s%s%c%srevoked ca %s: loading entries for host "%.100s" from file "%s"@cert-authority@revokedInvalid hashed host line %lu of %sWarning: %s, line %lu: keysize mismatch for host %s: actual %d vs. announced %d.Warning: replace %d with %d in %s, line %lu.%s: found %skey type %s in file %s:%lu%s: loaded %lu keys%s: invalid marker at %s:%luno key to look upaadd_host_to_hostfile: host_hash failedadd_host_to_hostfile: saving key in %s failedDAEMONQUIETUnrecognized internal syslog level code %d Unrecognized internal syslog facility code %d Couldn't open logfile %s: %s debug3debug2debug1internal errorfatal%.500sFATALERRORINFOVERBOSEDEBUGDEBUG1DEBUG2DEBUG3AUTHAUTHPRIVLOCAL0LOCAL1LOCAL2LOCAL3LOCAL4LOCAL5LOCAL6LOCAL7channel %d: close_readchannel %d: chan_shutdown_read: shutdown() failed for fd %d [i%d o%d]: %.100schannel %d: chan_shutdown_read: close() failed for fd %d: %.100schan_set_istate: bad state %d -> %dchannel %d: input %s -> %schan_set_ostate: bad state %d -> %dchannel %d: output %s -> %schannel %d: send eofchannel %d: cannot send eof for istate %dchannel %d: send ieofchannel %d: cannot send ieof for istate %dchannel %d: close_writechannel %d: chan_shutdown_write: shutdown() failed for fd %d: %.100schannel %d: chan_shutdown_write: close() failed for fd %d: %.100schannel %d: send oclosechannel %d: cannot send oclose for ostate %dchannel %d: read failedchannel %d: chan_read_failed for istate %dchannel %d: ibuf emptychannel %d: chan_ibuf_empty for non empty bufferchannel %d: chan_ibuf_empty for istate %dchannel %d: obuf emptychannel %d: chan_obuf_empty for non empty bufferchannel %d: internal error: obuf_empty for ostate %dchannel %d: rcvd eowchannel %d: rcvd eofchannel %d: rcvd ieofchannel %d: protocol error: rcvd_ieof for ostate %dchannel %d: rcvd closechannel %d: protocol error: close rcvd twicechannel %d: rcvd oclosechannel %d: protocol error: rcvd_oclose for istate %dchannel %d: write failedchannel %d: send eowchannel %d: must not sent eow on closed outputchannel %d: chan_write_failed for ostate %dchannel %d: zombiechannel %d: is deadchannel %d: active efd: %d len %dchannel %d: is dead (local)channel %d: send closechannel %d: cannot send close for istate/ostate %d/%dchannel %d: already sent closechannel %d: almost deadwait_ocloseclosedwait_ieofpacket_set_tosFinished discarding for %.200spacket_set_connection: cannot load cipher 'none'Compression already enabled.packet_set_encryption_key: unknown cipher number %dpacket_set_encryption_key: keylen too small: %dpacket_set_encryption_key: keylen too big: %dset_newkeys: mode %dset_newkeys: rekeyingnewkeys: no keys for mode %dpacket_send2: adding %d (len %d padlen %d extra_pad %d)outgoing seqnr wraps aroundXXX too many packets with same keyenqueue packet: %udequeue packet: %uWrite failed: %.100sWrite connection closedConnection to %.200s timed out while waiting to writepacket_disconnect called recursively.Disconnecting: %.100sPacket corruptBad packet length %u.padding error: need %d block %d mod %dCorrupted MAC on input.internal error need %dincoming seqnr wraps aroundCorrupted padlen %d on input.Invalid ssh2 packet type: %dReceived SSH2_MSG_IGNORERemote: %.900sReceived disconnect from %s: %u: %.400sReceived SSH2_MSG_UNIMPLEMENTED for %ucrc32 compensation attack: network attack detecteddeattack denial of service detectedpacket_read_poll1: len %d != buffer_len %d.Corrupted check bytes on input.Invalid ssh1 packet type: %dReceived disconnect from %s: %.400spacket.cConnection to %.200s timed out while waiting to readRead from socket failed: %.100sConnection closed by %.200sProtocol error: expected packet type %d, got %d%s: set IP_TOS 0x%02xsetsockopt IP_TOS %d: %.100s:setsockopt IPV6_TCLASS %d: %.100s:%s: set IPV6_TCLASS 0x%02xpacket_set_maxsize: called twice: old %d new %dpacket_set_maxsize: bad size %dpacket_set_maxsize: setting to %drekey after %lld bytes, %d seconds/usr/libexec/openssh/ssh-askpassread_passphrase: stdin is not a ttyread_passphrase: can't open %s: %sSSH_ASKPASSssh_askpass: fflush: %sinternal error: askpass undefinedssh_askpass: pipe: %sssh_askpass: fork: %sssh_askpass: dup2: %sssh_askpass: exec(%s): %srsa_public_encrypt() exponent too small or not oddrsa_public_encrypt() failedrsa_public_encrypt: BN_bin2bn failedrsa_private_decrypt() failedrsa_private_decrypt: BN_bin2bn failedrsa_generate_additional_parameters: BN_new failedrsa_generate_additional_parameters: BN_CTX_new failedrsa_generate_additional_parameters: BN_sub/mod failedtty_make_modes: no fd or tiotcgetattr: %.100scfsetispeed failed for %dcfsetospeed failed for %dIgnoring unsupported tty mode opcode %d (0x%x)parse_tty_modes: unknown opcode %dparse_tty_modes: n_bytes_ptr != n_bytes: %d %dSetting tty modes failed: %.100sxmalloc: zero sizexmalloc: out of memory (allocating %lu bytes)xcalloc: zero sizexcalloc: nmemb * size > SIZE_T_MAXxcalloc: out of memory (allocating %lu bytes)xrealloc: zero sizexrealloc: nmemb * size > SIZE_T_MAXxrealloc: out of memory (new_size %lu bytes)xasprintf: could not allocate memoryaddr_match_listaddr_match_cidr_list%s: couldn't parse address %.100sInconsistent mask length for network "%.100s"%s: empty entry in list "%.100s"%s: list entry "%.100s" too long0123456789abcdefABCDEF.:/%s: list entry "%.100s" contains invalid charactersInvalid network entry "%.100s"key_equal_publickey_ecdsa_nid_from_namekey_ecdsa_key_to_niddsa_generate_private_keyecdsa_generate_private_keyrsa_generate_private_keykey_from_privatekey_cert_copykey_to_certifiedkey_drop_certkey_cert_check_authoritykey_curve_name_to_nidkey_curve_nid_to_bitskey_curve_nid_to_nameaeiouybcdfghklmnprstvzxkey_writekey_certifykey_ec_nid_to_evpmdkey_ec_validate_publiccert_parsekey_ec_validate_privatewrite_bignum: BN_bn2dec() failedkey_new: RSA_new failedkey_new: BN_new failedkey_new: DSA_new failedkey_new: bad key type %dkey_new_private: BN_new failedkey_free: key is NULLkey_free: bad key type %d%s: BN_CTX_new failedkey_equal: bad key type %dSSH_FINGERPRINT_TYPEsha1:ssh-unknownkey_type_from_name: unknown key type '%s'%s: unknown/non-ECDSA key type '%s'%s: BN_CTX_new() failed%s: EC_GROUP_new_by_curve_name failed%s: EC_KEY_set_group%s: nid = %d%s: DSA_new failed%s: DSA_generate_parameters failed%s: DSA_generate_key failed.%s: RSA_new failed%s: key generation failed.key_generate: cert keys cannot be generated directlykey_generate: unknown type %d%s: invalid key lengthkey_from_private: BN_copy failed%s: EC_KEY_set_public_key failedkey_from_private: unknown type %d%s: nprincipals (%u) > CERT_MAX_PRINCIPALS (%u)key names ok: [%s]key_sign: invalid key type %dkey_verify: invalid key type %dkey_demote: RSA_new failedkey_demote: BN_dup failedkey_demote: DSA_new failedkey_demote: EC_KEY_new_by_curve_name failedkey_demote: EC_KEY_set_public_key failedkey_is_private: bad key type %d%s: legacy ECDSA certificates are not supported%s: key has incorrect type %sCertificate invalid: not a host certificateCertificate invalid: not a user certificate%s: system clock lies before epochCertificate invalid: not yet validCertificate invalid: expiredCertificate lacks principal listCertificate invalid: name is not a listed principalnistp256nistp384nistp521%s: unsupported EC curve name "%.100s"%s: unsupported EC curve nid %dkey_to_blob: key == NULLkey_to_blob: unsupported key type %dkey_fingerprint_raw: bad digest type %dkey_fingerprint_raw: bad key type %dkey_fingerprint_raw: blob is nullkey_fingerprint: null from key_fingerprint_raw()%02x:+--[%4s %4u] .o+=*BOX@%&#/^SEkey_fingerprint: bad digest representation %d%s: no cert data%s: no signed certificate blobkey_write: failed for RSA key%s %s%s: key lacks cert info%s: CA key has unsupported type %s%s: signature operation failed%s: certificate has unknown type %d%s: invalid nid %d%s: group is not a prime field%s: received degenerate public key (infinity)%s: BN_CTX_get failed%s: EC_GROUP_get_order failed%s: EC_POINT_get_affine_coordinates_GFp%s: public key x coordinate too small: bits(x) = %d, bits(order)/2 = %d%s: public key y coordinate too small: bits(y) = %d, bits(order)/2 = %d%s: BN_CTX_tmp failed%s: EC_GROUP_mul failed%s: received degenerate public key (nQ != infinity)%s: BN_sub failed%s: public key x coordinate >= group order - 1%s: public key y coordinate >= group order - 1key_from_blob: can't read key typekey_from_blob: can't read rsa keykey_from_blob: can't read dsa keykey_from_blob: can't read ecdsa curvekey_from_blob: ecdsa curve doesn't match typekey_from_blob: EC_KEY_new_by_curve_name failedkey_from_blob: EC_POINT_new failedkey_from_blob: can't read ecdsa key pointkey_from_blob: EC_KEY_set_public_key failedkey_from_blob: cannot handle type %s%s: parse errorUnknown certificate type %u%s: Too many principals%s: Principals data invalid%s: critical option data invalid%s: extension data invalid%s: Signature key invalid%s: Invalid signature key type %s (%d)%s: Invalid signature on certificate%s: Certificate signature verification failedkey_from_blob: can't parse cert datakey_from_blob: remaining bytes in key blob %dkey_read: claimed key size %d does not match actual %dkey_read: missing whitespacekey_read: invalid curvekey_read: missing keytypekey_read: short stringkey_read: type mismatchkey_read: uudecode %s failedkey_read: key_from_blob %s failedkey_read: type mismatch: encoding errorkey_read: type mismatch: EC curve mismatchkey_read: bad key type: %dkey_read: loaded key is not a cert%s: private key too small: bits(y) = %d, bits(order)/2 = %d%s: private key >= group order - 1RSA1ssh-rsaRSAssh-dssDSAecdsa-sha2-nistp256ECDSAecdsa-sha2-nistp384ecdsa-sha2-nistp521ssh-rsa-cert-v01@openssh.comRSA-CERTssh-dss-cert-v01@openssh.comDSA-CERTecdsa-sha2-nistp256-cert-v01@openssh.comECDSA-CERTecdsa-sha2-nistp384-cert-v01@openssh.comecdsa-sha2-nistp521-cert-v01@openssh.comssh-rsa-cert-v00@openssh.comRSA-CERT-V00ssh-dss-cert-v00@openssh.comDSA-CERT-V00dispatch_protocol_error: type %d seq %uprotocol errordispatch_protocol_ignore: type %d seq %uprotocol error: rcvd type %dderive_ssh1_session_idHm, kex protocol error: type %d seq %udiffie-hellman-group1-sha1gss-kex_parse_kexinit: %skex_parse_kexinit: first_kex_follows %d kex_parse_kexinit: reserved %u Unsupported KEX algorithm "%.100s"kex names ok: [%s]SSH2_MSG_NEWKEYS sentexpecting SSH2_MSG_NEWKEYSkex.cSSH2_MSG_NEWKEYS receivedkex_send_kexinit: no kex, cannot rekeyKEX_INIT_SENTkex_send_kexinit: kex proposal too shortSSH2_MSG_KEXINIT sentclient->serverserver->clientSSH2_MSG_KEXINIT receivedkex_input_kexinit: no kex, cannot rekeyno matching cipher found: client %s server %smatching cipher is not supported: %sno matching mac found: client %s server %sunsupported mac %sno matching comp found: client %s server %szlib@openssh.comzlibunsupported comp %skex: %s %s %s %sUnable to negotiate a key exchange methodunsupported kex alg %sno hostkey algbad hostkey alg '%s'proposals matchproposal mismatch: my %s peer %sskipping next packet (type %u)Unsupported key exchange %dresume@appgate.combad kex md size %dkex_derive_keys%s: bad host modulus (len %d)%s: bad server modulus (len %d)diffie-hellman-group14-sha1diffie-hellman-group-exchange-sha1diffie-hellman-group-exchange-sha256ecdh-sha2-nistp256ecdh-sha2-nistp384ecdh-sha2-nistp521gss-gex-sha1-gss-group1-sha1-gss-group14-sha1-mac %s len %dmac_setup: found %smac_setup: unknown %smac_init: no keymac_compute: mac too long %u %lumac_compute: unknown MAC typebad mac %s [%s]mac ok: %s [%s]macs ok: [%s]hmac-sha1hmac-sha1-etm@openssh.comhmac-sha2-256hmac-sha2-256-etm@openssh.comhmac-sha2-512-etm@openssh.comhmac-sha1-96hmac-md5hmac-md5-96hmac-ripemd160hmac-ripemd160@openssh.comumac-64@openssh.comumac-128@openssh.comhmac-sha1-96-etm@openssh.comhmac-md5-etm@openssh.comhmac-md5-96-etm@openssh.comhmac-ripemd160-etm@openssh.comumac-64-etm@openssh.comumac-128-etm@openssh.compermanently_drop_suidpermanently_set_uidtemporarily_use_uid: %u/%u (e=%u/%u)getgroups: %.100sinitgroups: %s: %.100ssetegid %u: %.100sseteuid %u: %.100spermanently_drop_suid: %usetresuid %u: %.100s%s: was able to restore old [e]uid%s: euid incorrect uid:%u euid:%u (should be %u)restore_uid: (unprivileged)restore_uid: temporarily_use_uid not effectiverestore_uid: %u/%upermanently_set_uid: no user givenpermanently_set_uid: temporarily_use_uid effectivepermanently_set_uid: %u/%usetresgid %u: %.100s%s: was able to restore old [e]gid%s: egid incorrect gid:%u egid:%u (should be %u)dump_base64: len > 65536 percent_expandread_keyfile_linemktemp_protosock_set_v6onlyfcntl(%d, F_GETFL, 0): %sfd %d is O_NONBLOCKfd %d setting O_NONBLOCKfcntl(%d, F_SETFL, O_NONBLOCK): %sfd %d is not O_NONBLOCKfd %d clearing O_NONBLOCKfcntl(%d, F_SETFL, ~O_NONBLOCK): %sgetsockopt TCP_NODELAY: %.100sfd %d is TCP_NODELAYfd %d setting TCP_NODELAYsetsockopt TCP_NODELAY: %.100s "=[%s]:%dput_host_port: asprintf: %sput_host_port: %saddargs: argument too longreplacearg: argument too longreplacearg: tried to replace invalid arg %d >= %dtilde_expand_filename: ~username too longtilde_expand_filename: No such user %stilde_expand_filename: No such uid %ldtilde_expand_filename: Path too long%s: NULL replacement%s: too many keys%s: string too long%s: unknown key %%%c%s: %s line %lu exceeds size limitCouldn't open /dev/null: %s dup2: %s tohex: length > 65536clock_gettime: %sTMPDIR/tmp/ssh-XXXXXXXXXXXX%s/ssh-XXXXXXXXXXXX%s: template string too shortaf11%s: set socket %d IPV6_V6ONLYsetsockopt IPV6_V6ONLY: %saf12af13af21af22af23af31af32af33af41af42af43cs0cs1cs2cs3cs4cs5cs6cs7eflowdelaythroughputreliabilitymm_send_fdmm_receive_fd%s: sendmsg(%d): %s%s: sendmsg: expected sent 1 got %ld%s: recvmsg: %s%s: recvmsg: expected received 1 got %ld%s: no message header%s: expected type %d got %dssh_dss_sign: no DSA keyssh_dss_sign: sign failedbad sig size %u %uincorrectssh_dss_verify: no DSA keyssh_dss_verify: cannot handle type %sssh_dss_verify: remaining bytes in signature %dbad sigbloblen %u != SIGBLOB_LENssh_dss_verify: DSA_SIG_new failedssh_dss_verify: BN_new failedssh_dss_verify: BN_bin2bn failedssh_dss_verify: signature %sssh_ecdsa_signssh_ecdsa_verify%s: no ECDSA key%s: sign failed%s: cannot handle type %s%s: remaining bytes in signature %d%s: ECDSA_SIG_new failed%s: remaining bytes in inner sigblob%s: signature %s0!0 +0 0 *H ssh_rsa_sign: no RSA keyssh_rsa_sign: EVP_get_digestbynid %d failedssh_rsa_sign: RSA_sign failed: %sslen %u > len %ussh_rsa_sign: slen %u slen2 %ussh_rsa_verify: no RSA keyssh_rsa_verify: RSA modulus too small: %d < minimum %d bitsssh_rsa_verify: cannot handle type %sssh_rsa_verify: remaining bytes in signature %dssh_rsa_verify: len %u > modlen %ussh_rsa_verify: add padding: modlen %u > len %ussh_rsa_verify: EVP_get_digestbynid %d failedbad hashlenbad siglenRSA_public_decrypt failed: %sbad decrypted len: %d != %d + %doid mismatchhash mismatchssh_rsa_verify: signature %scorrectdh_pub_is_validmoduli:%d: type is not %dmoduli:%d: invalid moduli tests flagmoduli:%d: invalid primality trial countmoduli:%d: invalid prime lengthmoduli:%d: truncatedparse_prime: BN_new failedmoduli:%d: could not parse generator valuemoduli:%d: could not parse prime valuemoduli:%d: prime has wrong size: actual %d listed %dmoduli:%d: generator is invalidBad prime description in line %dinvalid public DH value: negativeinvalid public DH value: <= 1invalid public DH value: >= p-1bits set: %d/%dinvalid public DH value (%d/%d)dh_gen_key: need < 0dh_gen_key: dh->p == NULLdh_gen_key: group too small: %d (2*need %d)dh_gen_key: BN_new faileddh_gen_key: BN_rand failedDH_generate_keydh_gen_key: priv key bits set: %d/%ddh_gen_key: too many bad keys: giving updh_new_group_asc: DH_newBN_hex2bn pBN_hex2bn gdh_new_group: DH_new/etc/ssh/moduli/etc/ssh/primesWARNING: %s does not exist, using fixed modulusFFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE45B3DC2007CB8A163BF0598DA48361C55D39A69163FA8FD24CF5F83655D23DCA3AD961C62F356208552BB9ED529077096966D670C354E4ABC9804F1746C08CA18217C32905E462E36CE3BE39E772C180E86039B2783A2EC07A28FB5C55DF06F4C52C9DE2BCBF6955817183995497CEA956AE515D2261898FA051015728E5A8AACAA68FFFFFFFFFFFFFFFFWARNING: no suitable primes in %sWARNING: line %d disappeared in %s, giving upFFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE65381FFFFFFFFFFFFFFFFbuffer_put_ecpoint_retbuffer_put_ecpointbuffer_get_ecpoint_retbuffer_get_ecpoint%s: giant EC point: len = %lu (max %u)%s: EC_POINT_point2oct length mismatch%s: buffer error%s: invalid point%s: EC_POINT too long: %u > max %u%s: EC_POINT buffer is empty%s: EC_POINT is in an incorrect form: 0x%02x (want 0x%02x)ssh_msg_send: type %ussh_msg_send: writessh_msg_recv enteringssh_msg_recv: read: headerssh_msg_recv: read: bad msg_len %ussh_msg_recv: read: %sOpenSSL version mismatch. Built against %lx, you have %lxPRNG is not seededDelegating credentialshost@%s+Rekey has happened - updating saved versionsplain_key_blobrevoked_certs_for_ca_keyis_key_revokedssh_krl_set_commentssh_krl_revoke_cert_by_key_idssh_krl_revoke_key_explicitssh_krl_revoke_key_sha1SSHKRL revoked_certs_generatessh_krl_to_blobchoose_next_statessh_krl_check_keyssh_krl_from_blobparse_revoked_certsssh_krl_file_contains_key%s: key_drop_cert%s: new CA %s%s: revoked by key SHA1%s: revoked by explicit key%s: revoked by key ID%s: revoked by serial%s: strdup%s: revoke %s%s: revoke type %s%s: revoke type %s by sha1%s: serial %llu:%llu state 0x%02x%s: finish state 0x%02x%s: start state 0x%02x%s: insane bitmap gap%s: serial final flush for state 0x%02x%s: serial done %s: key ID %s%s: key len %u %s: hash len %u %s: signature key len %u%s: signature sig len %u%s: contig %llu last_gap %llu next_gap %llu final %d, costs:list %llu range %llu bitmap %llu new bitmap %llu, selected 0x%02x%s restart%s: checking key%s: key okay%s: checking CA key%s: not a KRL%s: alloc failed%s: KRL truncated%s: KRL unsupported format version %u%Y%m%dT%H%M%SKRL version %llu generated at %s%s%s%s: first pass, section 0x%02x%s: invalid signature keybad signaure on KRL%s: second pass, section 0x%02x%s: subsection type 0x%02x%s: update failed%s: bitmap bits < 0%s: bitmap wraps u64Unsupported KRL certificate section %uKRL certificate section contains unparsed data%s: bad SHA1 lengthUnsupported KRL section %uKRL section contains unparsed dataAll keys used to sign KRL were revokedKRL not signed with any trusted keyRevoked keys file not accessible - refusing public key authenticationRevoked keys file not readable - refusing public key authenticationInvalid KRL, refusing public key authentication%s: %s is not a KRL file%s: checking KRL %s0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-detect_attack: bad length %dInstalling crc compensation attack detector.Couldn't obtain random bytes (error %ld)/proc/%ld/fdxmmapmkstemp("%s"): %s/var/run/sshd.mm.XXXXXXXX%s: ftruncate: %sABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/BKMGTPE@0B%lld%c%lld.%1lld%cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sunknown option -- %coption requires an argument -- %cPOSIXLY_CORRECTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789too largessh_selinux_setup_variablesssh_selinux_setup_exec_contextssh_selinux_getctxbynamemls_range_allowedssh_selinux_setup_ptyssh_selinux_change_contextssh_selinux_copy_contextoom_adjust_setupoom_adjust_restore%s: setting execution contextSELINUX_ROLE_REQUESTEDSELINUX_LEVEL_REQUESTEDSELINUX_USE_CURRENT_RANGEget_default_type: failed to get default type for '%s'get_user_context: obtained context '%s' requested context '%s'%s: security_getenforce() failed%s: SELinux PAM variable setup failure. Continuing in permissive mode.%s: SELinux PAM variable setup failure. Aborting connection.failed to allocate security contextfailed to allocate selinux context%s: current connection level '%s'%s: src:%s dst:%s%s: Failed to get default SELinux security context for %s%s: Failed to set SELinux execution context %s for %s%s: SELinux failure. Continuing in permissive mode.%s: SELinux failure. Aborting connection.permit MLS level %s (user range %s)deny MLS level %s (user range %s)%s: setting TTY context on %s%s: getexeccon: %s%s: getfilecon: %s%s: security_compute_relabel: %s%s: setfilecon: %s%s: getcon failed with %s%s: unparseable context %s:unconfined_t:%s: setting context from '%s' to '%s'%s: setcon %s from %s failed with %s%s: setcon failed with %sr+error reading %s: %serror writing %s: %sSet %s from %d to %dSet %s to %d/proc/self/oom_score_adj/proc/self/oom_adjenabledSELinux support %s/dev/random/dev/urandomSSH_USE_STRONG_RNGcannot read from %s, %sEOF reading %ssys_tun_opentap%dtun%d/dev/net/tun%s: failed to open tunnel control interface: %s%s: invalid tunnel id %x: %s%s: failed to configure tunnel (mode %d): %s%s: tunnel mode %d fd %d%s: %s mode %d fd %d۲   LHd.@2(33d4L556t78:H<<>:H(J KMNRWWHXYZh^H_%aTb\c\defXi jxj0kk mdn(tppqs\sttpw'Px2y,P{'|%}HLԁȏđ4lܚ``4XTDH(< |?Hh|hX8   l     l( Dh<L`< L" &+ 01 ;0>>|?4@AB#EEdHJ?lKL(M |OPQRHTcdfghhi mPnn|ortw z}0 H"L؋HȒ @x(xН(\P|48" 4hH|4@ (t0`ht0  (  D tL(t|(h  "x&(0/ 586 7P788:`; <=>BClDE4FGhHH JJMNT hV@WX8Y>BDE`FGJHM4`P?S V4XYpZ[d] ^@_```Pbd eefdffHgh\hPiidjjlkkl$mmn$o4ppq(r0sstxtHuLvvwj>$j?@j@TjAtjWjWjjjjkW4kV@kPk`klk|kk)kkkk0kk l $l!0l#Ls( D=XYRA 0~NDGB MĚQG@]o> rUSZxJZj2tDoKh4v0sB JEy5-W?$ ('gW%"rj?]Ճ.ïhٗI3 Em'X6m>b:_h!}BgV^DLT0x񑧶se9+d_J9+d֓#NM"9rvec]N;gNxGqPഉU<{u mG <ŲorP=aՏ?`;ҾUDO޼ Wo\?`}W$W>1T_`rD9_W徭Bϫ/O,}r>#>"b_eX=;'K7E>~phA[dYɊrO6N0v$Z3=tL[)¡Rſ bi'Xr@0= ^g;خ<a*޽ZS󞦌YXf3ɺf~i҄|$#SLAuC+;0%OI4Ғ?Wy4E?n7pz}S>7R{8Y H*5Hl㲜;J/\,q L!PN"I`fhID F}t<T nEPuv6*nd׏aSD sv6.#f`A2S9|®ߍ$M1AɹUOAkQ6}^n p`w)۔>{56>|'LT#9d=1Njz ԞETZp4֍ y4~5ӭk7A|YspYs_6-3] n61blӟ߱t}hӊA*0b苋SVM`^;Ew@<Ӹzb d,i ^ϮKSw}0[kcog,0n4JC})QΓq%Hd;D7\6mkĻN/xU Lx|{PhFz0A/a `y,7RZc+O/k R\Bq1& 9ܮLR]ea%Ϸg΄-4 4T׋9μ&'PNs q`f}УNRl|)7%^fI*_q_L=rx؜{ ň5oHcJW!H-5 xZV; 0/wmAYtފ]7@9C9; >]y`Lq/*A}E<3l^8 ʩDެuIla+pqzʥߌ^h onj]G@Y_| *5iV7bJ}/VGoO43@|ԫ(ufe<4̑j2s+S%0\$BIPW&v~^3t;[5Oz8a TLuP@:6'ZJfI lIіwhuY\ʎ&e # ڦi Mo gVs&lD劰cS \MƖ(Mn9`>V&T4LFt鞢PHzo(n5H܇J|r4 mT>4{'!Ћa^D/0[Sʶea.z1 ;N`<B-2лӯnMks>:#'0ϩ}uf]rP 5@tq_q@U E[9#BW_䏄6DEːnAv-f[͏ՆmՊNJI["P:[js.zT^Wv]$& " ֖IC0Yr}TJ}z̕:"F(}!m,҄QU0|`E Qȧ9/w;a !46Wyj]_ tb̞/^b0VZ}K %Pƙ4/qii&VJ6[pepoe{7/Z/_M̘_q!'6HHvC3R/@Rv8XL.W3oɮQ>{F^/QHZ^ vndi'R,a7)GW몵Xͽoiv,[U'T5 >u%Sg=K|[)sc&@MQ+ۆ@f+Vi~5^'`.)ȟ]y+dbu+D|TV9483:t듸]a 1Z[@JuAa:$}' U o;g1VJW+KA0WTmz~WzEM2g ӝS'4BlȮ_2xx cFkudƬ7 I>89cqཿB):R&ڂ m'ފHչ!V`WMVaDe4wz p/vT{LؒqYїU.P|q#7MД UYP_O#/Ctʝ|mQؗͭsQ5B!Wk[ 6s4T'tC*.9\ A:uۣQ$0 r9d/bz_>zo%gEXly~ ebз@R^y< #|֏B' D칒1=rJ)_S6fDJ>=v?ma9Ң0;%"+:B-Ycl#P*!nP3eg.' Q;,:Nc)ZWx:\7a| QeL,'TD^2G^OG|=Fug+;M ¨ A,)ߏ!}Fӗ:Jȯ2D[KmY@y8A'.L<6"T@Ot3㏼UvxڜEcA1蕿 GcV: jHO$ } oTF&_ `m+=l$80ơp B 5Ԋ Ex6^40:nǪH0, :rZnp|=ȵ2gW X@*j4kO:ab16W}Eb0Ÿb a-/Zƞd;y `qOpybxl2CGf $[=,)9 >uiJVG!IZmZRSa?Ϩ_<]j07癋eڌ\T&jv6<z}\?+6qdlT~}8m+!ܣFFY8G40YOzJhQӶj]ܸt p_%9tmh삽)9YIۨuu%]ٺv/t%d崏[z h!Y;i TÉ@qba? <Q>Mb1yac4TXNhiooBcY_ >%E.ߚg/\'B$-4sSwg&e #r\bm9=A6G:MWxdL2j'T 3nX]`/MHOykbYCV݊܃pcdETbJHch{窯ka&}}Tr&Z *)R0 Zo;CW',J*cңGц g3KF.cj6䌺K:Zu X…nR2d&Y m~"jQy0읿+[(%BϾnE5*;TtB>EFuyكݿ# a!G݌XVS;`~U N١U~Xfxu,.^kO)o@1ܸDfy;$6ʩWVU=ͻj#ٮj4vAbq7f]*# G7j)A,x/[*lEK/_@`ɱ˖sRTtR-3=P擔sl0!- 9F:֧"{Ә.%?]H ԉ'dU&};hmkNC܌҇zid<<4y? 0`y xtSj麕уZT]jH|F΢O8ׇٕd-91ScPm:1, f&x:fa-g9}3^{+jI(΋G| -Xt@"ԘPja/װ|<卖e59nʬYeZJr(rM"ʓMJA~Q` ҡy%_ 2eed |XE?m=֦ ZC-44uaz\5b 3hFgzWrj 7ϺyDuJkU%jb_@U/;9r,[n]U Ȥ.% |u|g&ZI9ý[X%6>,+k z{"zYbbz<^oFå!R<ƸBM/kr`!|nL?u]QkUevh͛~.ׯrа؊>3@GgܜZ*7:q2ӠXɡesGY`=ߪSU[CQ*ݖa>5.q3fy*'.#U9 U,#Lqx5~wFݏD%l`6H5mn%1q# U?젗!g䜏"t/(}F4m*I.-矶6ᠶ*,MH0SJQ4NԀfZ4Ҳ?r;ng ̹l G6&":3,X'ЈbuX"+P^cۆH2}qjHAp)S[uh7oe܉)$ͅ {M1/YJChU?S`Ÿ g]4SF}x}>kF`6 p[!#EJ$j[5Dn? ZàDIQ ~m4]3^1Wvt>a3ږW:qQ_D R`FD*ey4m{}\BNrϿkHÞd,ĐC-=,_)rr|CcUV҇xL a[ Qko=3W(*a% ol0ڣmF($-#r+-p6nuC4f'=]gnEӬK;:b~(ʁ2e2a/VOO}&R42l꾣TDy(ģlT=K"e1|pr7Y*HTl\RE CMu #98>4Lil.ERc?0h~OPɼϞzrչ9N'y|_5 C'6%LXG99@2 Zz5/{DO勳`#9C;| qVAJ D 7#Pm 6-G'h$qn#tw\t(i.#bAy͖ ug,VӰ.2ˠa2KFh*C2+j\.^FD>w Xb]VDγM˂;O]+<dKA"싂D@a1P5Xk׿gᵧh˄Y{pQwG-:,>CˋВ6ۆ/Y0uBg$*7oc<CT3KZM;x %e&3akw6KXTA <[BOVpQUG ӻ#d⮮6y΀&pv xz|q86=z/*E3v:'ECa~L|{Vy`5$GRjDMs^7r2-C㟢̋ݱb{g1q'G̈́v:ޗ^;M3 ΫHfd42h->׸R,sߔX H~tȍ9ojNL Յ7kc!*UYS3 H x)0v$p+X29:.Y|aECSKjZB 1ly Q{щ]4t-ЈfZk=*JNFhǂ8W*z&FA>0Տ'iv!d&U$N2XeHlH~&5xypP[, q`2<9k*? W/%i;Z-PuU `BȻ_av]t|\8|(2zB1N dQC|I"63/B]~aκ81 ]Ycr)4Z TJM2Cʻ1CyQ:JOVj0V`ᷓ1*IXnڑqmP+P6=-Ispq:kˣ! )Ȍ)sh,|?*CH{#/իm rA6HK$Lx%,Ȱ8[-b5c+DG(F8bNth`Afe@-"X5Ui,`]R?ϟMܝU/G[AD=}{ :` U uzȠ $%$:ϪdOR.q =_)o6ELsb' q[B%9*-,_e&d|zN3ofYj'(*G0>]iڱ +̸'nƿA= INц&L7j(}tT& *%u!~K\#bܿO?J+0-QrZVÖj8(uu(8kp\"˛ 4_ `Śj#-bb/N?8m53[nj"Q$[{*}wٗևOdL*NzdqpS(^UQ[~ Go xF=8ͱѸzPTھzf-6^N|wwfݔ.S}v^R]Pc 1 -`8atː,:mpdN (5+ ՓFtDŽɭ,Q=VUlfW)_E+*8.y=^wA5Nӣ1JVuןr` UG?fxy ~M~g rt ]̐3~ˮ>OӋ@҉oK\..:de|ljcH)0@\<}0?;Ee.o{DTmsh%m\޺c\ݘ?6ٹ&۲~W+g1"̒e7+'TZ=>H.e7 gT`"t0oM )f"t~[ֵR6.!N]L?e0׉3yRpD-&/lu7* y&%T7t/ 7aJ ?)7:c$1ꤸQ;9{)TCVG=W֕97=r +8~w_ve!FB|!E^ 3L8h4f'/63b(,,a.Mx>TNJx&"^06QІb> e_W4:qp,8bǜsO%$xIԡs?n*$M{<ېCF@Jd(O(k!Ć+QrB}F7~`Tﳡ6NK_Ǿ\[dqd\TՁ_ urFkШ腔W$\ѫÌg &7} րi$&|eYu:SǢ*ʒ:FֺdC;t(pRU$@_rdvJu83 q^pՃiЇ0`(BbS}J[\ 3°d PGB\jT\|vR*LV8),p1yQwYKUZTۦO<*.PZ >#}wgmX~E1U3Ue'P?Qb~CꙚ{1>X(KX& sxrkAf!Z:]}Ns,\,xYj#r^Oe ͂fO͘@@#&PCzj"L=H+z:"%5< .=F{F k>+mg.NT |T\!M{sƾ\g'NFxm'- rQګDkp*Ƴ6 XC@DG%_t,OIfM9~U?{+v!תFAsзjx7:C}veTb/LlIJ%Ҧs :ط|{&: 4χ6rLNðØZCaNo#B hXC.A1F,,8|L\/(|8o#T*LcyY_(6)e˟>rl\s/Sce2. 8\؜? 狿Ӳ'2V xd$24V6ӎ0=$6X3S15H]~>:+5y߇js+5t1rN%Jކ"jU?K"#^?`0O?4°1SLó)_DɒwS),}ʶ:$ >f Šr}'JujHV v|l[t ?Tߛqj+?ngaMkj(Jf^\і1H/I: Ѧh%94]$ ݻ ߧD4,p<,U|(֩]Ie}@ekOW~>o;} ̀*5Z>6ԼrGDzpdˎ׾ {:uǬ{z3حĖ?($W5S1(Ml^BY\Y ~6& PO0(?ijCk3|EL&fWJJ8ܻ?jZx^z%k c%yj@`ΨdPzwx$ @3mH} nhi +֘XqI.Rw+d?䧷rd.&c@j赦VY#abƓ3ZMP 8go)4ȼW 6{1Ja/z$/Wls2'`Rl>W#\ XVcZhXmCn}{ˆc!8!,\}QnDs&sOYtӇ&kѹU;e72My9Q4qz o:hZ~7 TkOu~`x%gf6H1d>J{_A2Q.MBF4.]deor`&X>@T}M+@9qA̗D4g~p\BE n,<.ŷOc6qbJ@9 ,Ik7_Y:H' ˾<|ۘW+; .Ú+C-Zs`Hec=XJI{j>ǡ֜~wbj>yDqr֍/qмIjeXf2V! l [#{cفE"hfuU`c\XEF"M5mp$pǻgYZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.extab.ARM.exidx.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata TTpp !$4o\> F /No::[o== j l?l?s LTLT |LbLb wXbXbpwpw00 0 0tM}}p$$8 \\" " " "  5 Եl7 l@ E U8,