@ CHSETTINGS/@ /@$/@(/@,/@0/@4/@8/@xV4?,? x) h H  //    /@ 00@-  ,@ PPPP P U9904@,0000 0S0X}0@1@- hP@`ppp`0\` V2P 2 P@@h@  \ R P@ @h@  \ RX}0@00@-  @@ P PPP 4P  9904@@000040 0X}0@$0  ( ( R/\}0@@-K_2\3  @@@0#p@ T99900000p0S2,0| 2  2 R`  ` R2d d Rl2 RT2  @2 R ! !R2 0S! 00000000S 00 R101 Rh10  T10 R@  @ R,1< < R1 R0  0 R 0S 0 0 RH  H0Sx 0d0 L L R@0 R0  RX}0@\}0@P}0@T}0@@-P@`p00000000 0 0000Vlp@`0t}p@p@-2`@00  0, 0, 0 P 0PxP#0`p@l>0@ 0S 3 + <     3    /`}0@ 3     $  (  , /, 3 , / D0 (  ,  P \ $ ` ( 4 8 / D @01    ! ! 4! 8!/>0@0 DH/DD-p`P@oI >@0 > >0 > >0 > >  $ 3DtD0P(&'  '(&/D0P &'  ' &/D@-  3 3}0@@G}0@|}0@@G}0@P/ P38 0s/p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pp,0    0 /$0     / 0 H ПP-0@@-pB@P`  LL@DL@0f@  ,$C0fP6O@T:D0@QE0@E0@//0 0 "0b0>?0S:0?/8@-P@?00 0#0?8@P/t Rl RP \ L0 R R   ,0 0 /O-p`@0@0@}0@}0@0 //D8@-@(0@@+ P8 <~I0 @8H@-;tI4 <0< S00b000PH@-,0<_I0 0 b 0 H@-@d0/}0@0/}0@@-@@-@00 S S S   }0@ПM 0@@-$0Р   `,; 0@0|0@/@-gP x; H0@mЈ0@j0@0@-@MP p:Pd]`[\YXDPP :P&5P @ 050 0.P@0@Dt@:80S 3 0ST%+ :Px!  u:PLpPdX f:P H Ѝ05H0@0@Ї0@0@0@>H0@D0@l0@X0@EH0@0@LH0@0@$0@UH0@^H0@/s@-PP @PPP 0P `T`0S P 0PQ |H0@}0@H0@U3I0@@- 0$  Sp@-M`P@   $ 0P /0 0@@@@V @$@ 0P } %0 c $ P V@$  0P@$ 0Ѝp @Q@-00P 0P@-%P"P@`@- 0@P * 0-@ 0 0 0P@- 0+P 0-@ 00 0 0P@- 0P PЍp@-2&".R -N 7/,S0SO ,S2NX Tf9PP @O`9P, (Z9P  S9P R$ Pw G9Po !PjT  0PP"P  ^P ,dUP^ @89P  00P  0P  9P. 0+(-F P$P-P? 0 P 0-P? 0 0 0 PT.8`=`#Pd9PDUH0@}0@5H0@}0@QI0@VI0@rI0@I0@@-XM* L2H @24 RU%H 4 R2"l "p H T 2T  T !X T00䁟T0{  QP2P P ,P 0! P "A0S P 0 P TQ D 4  q8P   @ d8P0/ 00% W8P0 00 J8P  D8Pʔ0/ 000  0x0XЍPDD D|0@I0@H0@H0@U3I0@LH0@I0@~0@@0@<@0@UH0@@0@>0@0?0@DI0@MI0@~0@?0@>0@l?0@?0@?0@17@-0&46S0S#< xR$0 AP\0  0 0 0 0  @  7P 0P6!0 0 7P  7P 0: P& 0 @P@p x7P  P 0  < \ 07P  n>>DI0@I0@}0@5H0@<~0@UH0@~0@EH0@\~0@-J0@LH0@DI0@F-`,M@@`FfR_ RVP=7P0 -R D"<1V  0Sp /6p3;p7W ,`PA  '0L R QCS( C00@d0P`@0 4x0S400 ,ЍRJ0@0@0@J0@T J0@0/0@@-<000Q 0 0S uЍJ0@PD-@P`0U@=S p`7Z 0S0=PN-pP`㬐" T`$@PP @e`P T`eV 0 0D(sP @J0@0@-(M@  0 (H 00 0J4P\ P\(Ѝ訃0@P@-01,03/\P@-01(03/\P@- 1 03/\ P/0  P/0  R/0  @-R0 00$03/@\-@-"M @T /( :@"ލ@Ѝ/@-0 @"M T 9@"ލH0@-@T  0S P P 0 8@-PT0 P@ bd6400T:(00T0@88LD I6LDp@-P0```N@N@JD T00Pdp0 cRH  a8p0`d``0 @d@p0@0@p@-@Pp0DR `QP 0a   010Rp81p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"~|`@ P  A Q R:  0 0p0@0@HF-50S50SP @T@~T*@5!1 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)~ | 41 d\ B \ 0 0 0   # P PPQ 00d\ 0 @0@0 PP \PP0 S *P1`C̅0 0 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ~|cQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0@ @ "00    \ 0   0 0 P`p    A BQ 0SS  0 1` 0dSf1 p1p0szpp~ppPN P*x1VIx1 U  T1 pp0p3DpiP  00cPp0g~p~ppp( 0e  p p0VPp Z0  0 J Z000 0  | t00S0h S0D00000dS( 0@@0LD0@H0@@-p0`PwW@P&P%  0@0V`s `R`V  B$RR0 R0000$R0 00000   3@0@D-@QTD> T@Z 5pP PG@BQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000yF-pR`PU PU 0S- @30P) @F30 s R @0 S T ,R:S,S: S8 0S 3P )3T" !* @@T0 S :SP0@0 R \03PPd 3P O32=Y0@0/ 0R00/PY0@@- 0S 0/PY0@@-P 1PyP YP tP T0Ps8@-P@   P@8@-@P 0!St:@(@\$0@0!0DDz1P8088 0400!  yK0@K0@0@PY0@@Y0@K0@L0@T P8Pp@- 0\ X\H@ `P` DRp\ PPps0@p@-@e2Pp,`R2PP fp p3[0@ L0@p@-@Q2P 4`>2PP fppp.[0@AL0@7@-@PX0000P00h P P#2P P01P P>L0@OJ0@L0@x@0@N-R0 @`2QP@Z  0KS{8/@8/@8/@\9/@9/@D:/@0 l 00( 0d 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 5 0\- W  .RR&pW)p0  0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ \@P @T ;1P 8 0 (ЍT{0@3[0@L0@L0@:M0@M0@RM0@/  /PY0@p@-PPD0@` 8@1P @T@pT5V0@0 000 /TP@-@P  Q1@@8@-@P ,0PS 00S P < 40 0@@ 0S@88V0@TP@-@P 0 uPW0@8@-@@PP 0P8P08P 0P/Ps@-@P` P `00 /hP0/@0@X0@@-:[0@ 02/R0  2/   2/ 2/ @ B 2/@  <0  /2*     /V'S0@@- 03/@-JF= P P :@PFP P AP  [ $f :[0@$ @-   4  @꼃0@d[0@/@-P @D-AM`0 F 0P@P Ty P@b. pP[0_ -Aލ[0@G/@[0@@-4@7   M0 @A @-@Vdd` `0 ;5PP T D8P,V$0@%[0@[0@0@[0@[0@[0@@-@P000@-0SP@-@1US1S 68 -P R$ -p3*_0@._0@N-M`0`@  ?0?0$ @0pMPG? 04/P$  !UQR yo?s/0 R@BC RQ@ \>QQ; Q9 < 0 0 8< 4 00 8< 4 0 000CSK/@K/@K/@K/@K/@K/@K/@K/@ a 00,00 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0   0fR 0 SK@_0@k_0@_0@_0@_0@_0@_0@S0@H- 0 `?0?0@0M?@?@0 < 8- 1R4!f4a>0@*`0@P`0@@-P@-,@02s0S 2-܃0@8@- O|P0"0- X0p  pPT @T*0q80 "8܃0@\`0@p@-O``,0p<DP0S Tp@T*0q0 "p܃0@`0@!0D-pxPPp! P dDP P:PJPP40Q0A0:s0  0 P *,0 !,0)o䠟*D,0@9s0`V0`j0 uP+0[0wp[0z0)*0 "s,U0 "0i00A00蠆@3`0@`0@ ܃0@`0@p@-`Q0:s0P@7DP0@I0j `0*^P  0 *r  0*(0s0S X0 0" @b@0 0 "p܃0@RN-`p 00Sr@j``0S$ 0 PM Pzh1 jX  P P1  P\ 0  j P   P  q" t0P 0"\  U D@@00TЍ a0@0a0@܃0@Pa0@F-Rp!4`@(P0:\ 3tP0q 00j@d00`P   T0ק0ֵ 90@`⸒PV@T@7 0 0"@ea0@a0@܃0@a0@a0@p@-@PB PP 4P 00#hWPP30Z.l0?Pp0h P($0 0CP Z 2/X R0Q3?\04 :Q000L ,L 0 RF _P—?P0Z000`4, ,P0@08004000 PO03? 03?$ZP00S3 Z

@  ᪠嫠#s3"0s 07(t0p SSs#<{ (x0S*S8(hpZލ"0@@0@A0@? A0@@x}@0@@0@uc0@c0@x0@00\0  00D01@01<01 1S? 1(0 0 /0@@a/@_/@ ^/@D- M@rP4j 40S 13/ PPDPnf P0,02 0S00 000P0S`200Xb_70 000 P1)0000 P0 ,000 S |P%0SUbPU*_10 R0C00P0 A :0 000 ^P6 pJp\` `` OP9W$P`` 00, 2 0 1 07P!$0SUPU*P0 8000T0S?@008:000 0 P @  P0040 Ѝ d0@ !d0@/p@-`DP@ < 0S $@Tp@Jd0@Qd0@s0@<0 @-@00(0 P,0@p@-P,1@00,1` fP p@`,1ptd0@e0@8@-@,00,0 PePd01 001 PeP((8@901 ,00,08>e0@\e0@e0@8@-(@000nPkeP0 ,14,1_P [eP8,1;(1@14@1,0<,0,1808,1,1<0;0,1<P9ePH,1 ,10,1(1<(1 0418\e0@{e0@e0@Ud0@30@-JO0Pp`0$&0101010U1 U00(00(0x0V<`,090P0\080P0 H0H0<0P Qe0@HX/@V/@q/@HH0-1uD-`H1Pp(@0003/P PV` [4/V  4/003/P 4P0 Pu4/U 4/z 4/Z 4/Z 4/x 4/V `0 4/P 4/00<3/P V  4/ 4/QD-`Pp@ 0V`c P#*VlFӃ (03/ (03/v  P0 (0`3/ z (0 3/(0 J3/&SR(0J 3/(0 3/pWW`WWW W00Sx`L"(0p 3/(0 3/03/@`V00SLD""DA 0@N-MH k1 PP0!P00 r ?R0s0SSWp1 x`00D 3/ 00 ,3/ 0-M0 3/+G B0  p3/ [0!H @ R 08S p  0phi0@^i0@s0@8@-P0 0@Q 0 S80P0H00D00@00< 0:00808 PA0@$/@,/@/@P0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p @T:00Sp0Xd@Q jP` @T*@m0Ppi0@@-`0P d@p @T:00SX1d@Qj`T0 P` @T :00S i0@N-pP㸐帰$`Z @ 0,@ S@R@dSI 0T T 0 SP 0 0@0@ @P0 ##U i0@i0@i0@j0@7@-<@ P& 5\P 0P>D-P<@pP d`#`V :p  0P Lm  0j0@D-M`p@P 0 (0`0# 030 RP @ 0T@ЍN-0`P00 0@P R0 p22000S( l 0T100#a0`10C@PS@P  -Ѝ跊0@F-M<@0D0  P0ßp`L  @ @2@P 00  0S(n,̎0 1 0 010LPPP @0brcPP'0 $` p0   040@ 0PRP 080 E#RT0 S0S <0 X\SH0p".d &.0h l0 H0, =x H0p.d .0h l0 H0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5oP(PUЍ2Tv"3.j0@D-p`@tPP{ o@P PPIG^|1 T040Dp@0 00L000H000P00* 0  Z00<@00 00,00$00(08"p0`py0,0000`  0@00< ; ;S s04 000M?M @ @ @ @  40,?<100ql0  00 0  0 /N- P@2#,p 2"4 2#000`J0`FV 0##0g!"(    "8 \  1#(00 P1!4P1#000v-l0@N- @P 2#,` 2"4 2#000 2"080 E $@P 0##0"py)(  Spy)4y)0霗)8 0S f-l0@N- P@2#,`00 2"4 2#000p,@P 0##0 2#(00 0!"80 @P 2#0 2#(000  2#800 0 \  P1!4P1#000 0h-l0@l0@p@-P@`6Q0!",` !!4!#000fJpE  1!41#000p``@@ Pp@oV 0p@T  0p@p1 ` 0/N-a\3ALĠ PPL PLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :Z bPf  cPf  bPf cP f   n. @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00l0@1D-@`` !v`R  . . !n.  r  w?  1PpzP  Zw Q PpUw?`Ppv`P  Vw  PpUN-`PMp  ;P@P > 11n?11=11l> >C> 0^1101 0S{0 Q'5$0B0@ Sq 0q>0t> 0x>0!00SC 3/PP@1S4 0 0S 3/0<q`00P4`uP < > 0> <>0>@ <>@0> <>0> <h>0> <L<0DD 0V0>0(T> T0>g?$|  \0 \%0 00w@0/0 0n010ሮp> X >PU`"|3 Rx/@0/@H/@T/@`/@l/@`PS `y PY1pZ. 0 x0 "0C$   Ա`Q&0!1S# P#p YC"p{/ , p̠NPP!0s0. RP0  pB# q !p>R1Q01q>0CS0|>|^oPPq>0Cs0S 1 00P00S 3/P4@PЍHV0@"m0@p0@rV0@m0@m0@.m0@:m0@Im0@Vm0@bm0@nm0@ym0@l0@\0@T{0@m0@S0@m0@m0@0@h0@0@܈0@0@0@D0@m0@b0@m0@n0@dB0@m0@Kn0@On0@n.1 (8 !< //!8@-@Q+! 1R 0S 3/$0 11& $88耵/@@-10S 3/p@-!Q0@T88#80t0w/00@4`  Va4`S1, @@P@TVp0$0pPQF-4P$ (@U,p0pPP-P` VP T> ㈮ZڡZեFFUPFuPSppWp W㶠p.p.pzW qUPfv``#F!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@ Ō|R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU<//0P10@//0PS#Q 3Q0@< r @   /F-p'@`PH V<0{,`(P$p.<0@0 0S Z00|0 tHV   @01P00NZ111400>.^P P0 Y0@IX0@T{0@n0@B0@lB0@@- 90@#Q004 R- `Rv`.@$ p$ pbQpp$wp` `$0p$p`u@-@@P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ@-0 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0嶠S0>>0>>0S8 1S 8 01S  0`Pv`p>S>0>00S 3/pB0@l0@///PQ@- (0<@<P!P: L0 q . 0D-`BPqT(T0{$`( `c@V@`# v00v`0@V$ S0T0n >嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

uP .00R R00>R771">PuP>S/@$/@/@/@/@/@H/@H 0q`RU (PU $0{`  0c`v`Vs`J Z$0?V0$0 S@0 0nH>嶠0S 00 0!0>2>>0  >Sa>00`Q (Q 0{0> Z $*# 0~{_  0`Q (Q > 2R>@0 0RB000 R0 .000.0>>S``000>>S S Q`0  QH Q Q>0>00>R :R R0AS0S0A#pz?P <004\ D\P <E0Q(AS|Qz vwR{ :RyP00CSr/@/@/@/@/@h/@>0,>Sf0c#4S S SZ S ST S SO 0 0 000 0@00>> 0>6>7 0>`00`0->. 0>) 0>" 0BS!0SB!p{P084Q P  r    00000.S0P ; `: 0S7 R0. :R/ .>.?8 00 G 0 |\ r0C"B"C //S4 R \00 0 0 0s00S00%S >S00 03/P"> 0>> x#te 000> `0_ Q#l> 0Ѝn0@B0@n0@p0@n0@n0@l0@o0@o0@@-pPc@t@ @`V@@t@$ @5@ Ro0@D-`@P0 p& PUwp00  Ro0@N-R(M`  0 \L 0  & R !0 $ , $\(b R ,\  R 0@c$ | 3{OR,P0PRp0r S qr  #  0w Z' 0 'p0#,- +r 0}0."   ! #$  S 0 0>1&0S >@ %p 0@(0"0C5s00!0 0!0 0> 0 0&0S>@ 0S1 Q !qQ $ t 00b40S0L  R 0s0   0s0 0+    t 0p /90 0>"0( !0# (00 $ (0  0 ! 0 >0( ! B%r  040 '0l 23& 0<R: P!0uP0S 0e#P:s0 000\&0S04020 0 0S 0S0    (Ѝ}o0@p0@o0@p0@N-`S,@p0@0& ssP0% BR V '  Vh l  | %  080  S 3/0% 0S>V1  $4 P 03/0$0 5 P5 03/ `10V,00000S0  &0S/@/@/@/@0SP 0P00 00@T @TN%0S NH0SN-PB{!Ta 0 @T@D@001qz~ r R| }  0s0q00T 00_.$(iSV S S& S6,0( c Z 1 { QJ0305S,02, S.(0[&:*0 % R01ŵ !0, ( bZ!zQ 0 ,0 ,#S 1S0 0 0`0(0S B0 !001 00F0T0T'q0@o0@q0@o0@N-Ȱ+ {0`VP 0 PUPEP 0U1@0t@Z BBpwpW 60! 000 R :(S@ \ c00sq Wp\ 0p ,00ЍN "B R@1 t q0@00pmpBM $@H0H0@@ 0!/ ЍN-P%Ա`{_,0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!4R B NpEp mu 0s0M  sr pwps&p,(0p |g \ J,pP,p ^psppW ps| Px0305q Yr  ?0] 0 0!0Ws0L0l00W0 sr 00N1 ?0E001Sj0F0  0 o0@q0@@-0S S@@+A CR 00@0S/0D p@-`P\ `@T  4/ppP   /S\S`/0S/@-@0pS S SI1`Faa`aa0PvfP  \cP*P0S S S"00``V0! V V0Pp 0 0"4  00Spp0  0Spp/D-p@ w000P0 ߠ0 `.00 eP`0 0S  S00D=@-`1p@0S@9@\PP  3P@*@ 81 S@` 0$`00-0` Sl P@@P P 0 8 P00@P Nq0@Wq0@`q0@N-MQ@` 1P!)?! ? p? F $!!M??+0  0 P- !1 @`c!V*Р p P @`bV ! p ? ? F !!M?P?P P Р РKiq0@00@-@ @ @T 0 S0P@P@PU 0@ S@000\0000Q 000F-Qp0P1P(` U #   @U7 RPE @uPT:JoP0 S?2P>1 <P  0R 0SPEuPU pBPᨐ PE Up @D |P0@ 0  0S  S00  Qq0@ xH-0P @?0?0@0M?P?P Pl `P 006H PR, P `KxP  r0@*_0@._0@x0 0@-TMP@ P T H 0@ @00,@L@0 TЍ0P r0@N-M(@D d ,0TP"d0P S`x*΍ ̰ h h X*hp !' T<*ppuPP `(* U  @{ S`G x` 0`GL` x`0@|0P`  0/S\S@@ F1Sʝ\\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8PH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ^ʝ\0V0 S! d/ S H 0NP IP\ 0R $ `$7 @F$\:d0P Sf0Ul `6 @pPRx 00 'p0p UP0c S030#SR ʝ\  @k|P 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%4P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  DDRpW P @ + 4zW 0 `4/ +40S 4 0! 4mP hP @ \( $$$D3(#$0 \:`PP(d0 S?2Pl:0,ʝ\00S/H0E @P \$d`( Qx2QP 0CⳠX\1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 \P @Q`d@g ZVI `hPP@d0 S?2P:* pY0@SP/d0 S2 0P)* pPW`:  0%P@`  0P`@`g2PTd0 S2 0P* p` pލ r0@T{0@ r0@r0@s0@ q0@ s0@@-@P,`p#00 0-s0@0 0@- ,@ #D$@@4$s0RB0@N-`p< @P0 0 0S 0  KY 0( P0` 0 Kcq'  P` `@@ V 0( ЍNЍu0@t0@t0@t0@t0@N-`@PW 303 :F0 `V p@PZUT# 2\WV:`Vp 0`Pd@ p@-@P`  00 0 0 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS:sQ mQ0@0ppT @-@Pd0    `0SPPp0U00T N- M DP H@ py0 0S**Q0 ` V v  V95P4@\+W) \  L0 k0[ 00`c    RZ/`F@`bZY W0  @X  @ 0 RZ/`F@`b 0 0C[ 00SZ[ 0 0SZVXЍu0@N-PMpPs%S0@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʐ@ 0 0 MS ISfiS mSa@@(0@: 0^, QQ @@06S(0@: 0[, , Q Q004S@@"($     l00S*[.00[00@@@( 0! v0 @!@` @H0>Pp0T0 F0 ` ?0= @ @%000S0PPpG. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S 0bPЍu0@s0@p@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:Pps0@@--\`@@-@-  : @ Ѝ/-@-  0Q꠆0 00( 0$ 0 0 0? /X ` d  l N-0ᤠ(p`0,@ `P  p`T_0 0!Y  U! Pl 0@p@-X XPX`0H@# <00S0d00  p@0X  ` u0@h0@-0SP0#aQ<@  R (A00@`@X \ h  v0@RN-M@` :n0?s0Si0?s0 SdpWaPU^0SZ   0 RQ0?s0S SJ (`|,0  @ 0    0 H*00S&  0P0U0P  S0 `XP(/0U{0@:|0@T0@t0@0@[{0@/i{0@x{0@/L///@-p3@`0Q20S " W S SV0PF?s0S S S2 ` @ 2pr D\P @0fS:@VUP<2_uPUP (2  2" ( 2PE Q#ʼQ̼!0Q S001!p00!0|!0l1Q tüNPq`1 R  L1PFH D1*0!q0C ## ! `i1 R`50U(@P 冼0-? {  /r 悼0?s00CSxk l0 dd@///0@{0@//0/y0@0{0@L0@050@T0@0@,/{0@z0@{0@{0@{0@` @-000P SDDM@_8:404,00S@/L0@|0@{0@Nz0@T0@050@/@-˻P  @2»PB  6Q*`T2/ PRP2Pr`0V0<2 HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOL D DpDHHH>0@8D}H @2SAɳf16$?;<t;@@@8(HX0@X0@X0@X0@X0@Y0@ Y0@+Y0@ #(-27<FP'@B  !"#$%&'()*+,-./01234567890gi0@0 ni0@0@ui0@0|i0@@i0@@ i0@@@i0@@i0@@i0@Pi0@D H@H`HHH{n0@n0@/@/@/@ /@/@/@p/@ /@d/@ܸ/@/@/@ /@/@2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x v7_dcache_inval_rangeResetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled A335BONESKU#01SKU#02A335X_SKA335BNLTUnknown board, cannot configure pinmux.Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM A33515BB1.500A1tps65217_reg_write failure tps65217_voltage_update failure No AC power, disabling frequency switch Could not get board ID. ddr_vtt_enboard_nameboard_revethaddr not set. Validating first E-fuse MAC Error %d registering CPSW switch ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lxenv_buf [%d bytes] too small for value of "%s" In: No input devices available! Out: No output devices available! Err: No error devices available! *** Warning - %s, using default environment Using default environment ERROR: Environment import failed: errno = %d at %s:%d/%s() env_common.c## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flagsethaddr:ma,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" ERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx CPU-## Loading init Ramdisk from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imagefilesystemFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedNULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialstdinstdoutstderrCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file, set_default_envbootcmd=mmc dev ${mmcdev}; if mmc rescan; then echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;if run loaduimagefat; then run mmcboot;elif run loaduimage; then run mmcboot;else echo Could not find ${bootfile} ;fi;else run nandboot;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxarocsdxbim### ERROR ### Please RESET the board ### U-Boot SPL 2013.01.01 (Jun 25 2013 - 16:42:52) spl: ymodem err - %s Loaded %d bytes autoloadyesNo Ethernet devices found ethactProblem booting with BOOTP (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") usbmmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d u-boot.imgspl: error reading image %s, err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_init_streammmc_write_datammc_init_setupmmc_set_iosmmc_reset_controller_fsmmmc_read_datammc_send_cmdTimeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters ECC: uncorrectable. NAND: Unable to find NAND settings in GPMC Configuration - quitting  SPI probe failed. SF: Failed to set up slave SF: Unsupported manufacturer %02x SF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80wait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out Could not get PHY for %s:%d %s:%d is connected to %s. Reconnecting to %s Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console SPI error: malloc of SPI structure failed SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x musb-hdrc~~UTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, bulk combine, bulk split, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d allocate_instancemusb_g_ep0_irqmusb_ep_programmusb_rx_reinitmusb_h_ep0_continuemusb_host_rxmusb_h_ep0_irqerror: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s writing %s (((((AAAAAABBBBBB %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s:%u: %s: Assertion `%s' failed.EPTGMK0123456789abcdef0123456789ABCDEF## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d bootfile*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameBOOTP broadcast %d AM335x U-Boot SPL Retry count exceeded; starting again %pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime, [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotatenounknownnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dipaddrgatewayipnetmaskserveripnvlan*** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) %lXfilesizefileaddr/ *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again /s TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx DDDDD /@2d}0@|}0@$0@0/@2d}0@}0@$0@  JJ  <~0@/@Ja; 3&PKPKa; Q&PKP2Sa0 Ԫ k&PKP0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ȁ0@Ȁ0@Ѐ0@Ѐ0@؀0@؀0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ȁ0@ȁ0@Ё0@Ё0@؁0@؁0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ȃ0@Ȃ0@Ђ0@Ђ0@؂0@؂0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@(8/@D8  !"#$%&'()*+,-./0123456789:<0@<0@.k0@/@/@x/@ik0@ܗ/@/@x/@:k0@ܗ/@/@x/@Ok0@ܗ/@/@x/@eserial0/@ܡ/@/@/@